DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and T20D3.5

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_501642.1 Gene:T20D3.5 / 177763 WormBaseID:WBGene00011858 Length:221 Species:Caenorhabditis elegans


Alignment Length:228 Identity:72/228 - (31%)
Similarity:125/228 - (54%) Gaps:32/228 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KTISLSIMFGVFDGTRRYLVEDYRL----------NDYG-AKVLAAVVAGSAESILLPFERVQTL 167
            :|.|.::|:|::|        ::::          :.:. ....||.::|..|::|.|.||||.|
 Worm     2 RTTSRALMYGLYD--------EFQISLKCPRSPPNSSFSICHAQAAFLSGVCEAMLCPLERVQVL 58

  Fly   168 LADSKFHQHFSNTQNAFRYVVSHHGYRELYRGLEPVFWRNGLSNALFFVLRE---------EASV 223
            |..:.||..|.||.:.|.. :..:||||.|||...:..||.|||.:||.||:         ..:.
 Worm    59 LQTTIFHDKFKNTLHTFNR-LRDYGYREYYRGFSVILIRNSLSNTIFFTLRDPLKQKIVGIPQAG 122

  Fly   224 RLPKRKSVSTRTVQEFIAGAVIGASISTIFYPLNVIKVSLQSEMGQRSEGSWQACKRIYVERDRR 288
            |||:...   :.:.:|:||:::||:|||.|:||.|||..:|:::|.:.|..::..:.::..|:|.
 Worm   123 RLPESLQ---QLIGDFVAGSLLGATISTAFFPLGVIKNHMQAKVGVKYESGFKVFRDVWQLRNRS 184

  Fly   289 IGNFYRGCPFNTGRSFISWGIMNTAYENLKKLM 321
            :...|.|...|..||.::|||:|:.|..|::.:
 Worm   185 LRGLYLGVHLNFTRSLVAWGIINSMYGILRRAL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 5/21 (24%)
Mito_carr 141..229 CDD:278578 37/97 (38%)
Mito_carr 235..322 CDD:278578 30/87 (34%)
T20D3.5NP_501642.1 Mito_carr 38..117 CDD:278578 34/79 (43%)
Mito_carr 131..217 CDD:278578 30/85 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167851
Domainoid 1 1.000 70 1.000 Domainoid score I6236
eggNOG 1 0.900 - - E1_KOG1519
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H88487
Inparanoid 1 1.050 124 1.000 Inparanoid score I3287
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59392
OrthoDB 1 1.010 - - D503015at33208
OrthoFinder 1 1.000 - - FOG0004171
OrthoInspector 1 1.000 - - oto19158
orthoMCL 1 0.900 - - OOG6_107186
Panther 1 1.100 - - LDO PTHR46131
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3422
SonicParanoid 1 1.000 - - X4548
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.