DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and slc25a53

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_002940455.1 Gene:slc25a53 / 100489481 XenbaseID:XB-GENE-6045975 Length:283 Species:Xenopus tropicalis


Alignment Length:296 Identity:88/296 - (29%)
Similarity:149/296 - (50%) Gaps:45/296 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 HGSVFSKRFFGSFQWEEFACGCGAAFVNIAVTYPIYKMIFRQMLHGVPITSAFAQLRHEGLGFLY 104
            |||.:|             .|..:.|::..:|:||||.||||.||.:.|..|..||..||...||
 Frog    13 HGSSYS-------------VGATSTFLSTVLTFPIYKTIFRQQLHTLTIREASQQLLKEGFAHLY 64

  Fly   105 RGMLPPLAQKTISLSIMFGVFDGTRRYLVEDYRLNDYGAKVLAAVVAGSAESILL-PFERVQTLL 168
            ||:.|||..||:..:::||.....::.|..:.::..:. :.|:.:::|:.|::|| ||||:|.:|
 Frog    65 RGLAPPLVAKTVQGTLLFGTQATFQKSLSGNGKVGHWD-RCLSGLMSGALEAVLLVPFERIQNIL 128

  Fly   169 ADSKFHQHFS------------NTQNAFRYVVSHHGYRELYRGLEPVFWRNGLSNALFFVLREEA 221
            .|.:.:..|.            :|||.|.:        .||||...:..||.|.:||:|..:|  
 Frog   129 QDGRNNARFPSANSILQEFQSYSTQNRFTF--------GLYRGFSVILARNALGSALYFSFKE-- 183

  Fly   222 SVRLPKRKSVS----TRTVQEFIAGAVIGASISTIFYPLNVIKVSLQSEMGQRSEGSWQACKRIY 282
                |.|.::|    ...|...::|:|.||..|.|.|||:|:..::|:.:|:....:.:..:.::
 Frog   184 ----PLRDALSLDGVPGWVPSLVSGSVNGALTSLILYPLSVLVSNMQAGVGKELPKTREVARAVW 244

  Fly   283 VERDRRIGNFYRGCPFNTGRSFISWGIMNTAYENLK 318
            ::....:...|||......||.|:||:....::.|:
 Frog   245 LQCGGNVSLLYRGASLIILRSCITWGVTTAIHDVLR 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 31/81 (38%)
Mito_carr 141..229 CDD:278578 29/100 (29%)
Mito_carr 235..322 CDD:278578 22/84 (26%)
slc25a53XP_002940455.1 Mito_carr 20..94 CDD:365909 31/73 (42%)
Mito_carr 101..189 CDD:365909 30/102 (29%)
Mito_carr 195..280 CDD:365909 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9694
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I4455
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D503015at33208
OrthoFinder 1 1.000 - - FOG0004171
OrthoInspector 1 1.000 - - oto104455
Panther 1 1.100 - - O PTHR46131
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.