DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and slc25a51

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_012809330.1 Gene:slc25a51 / 100135360 XenbaseID:XB-GENE-961321 Length:316 Species:Xenopus tropicalis


Alignment Length:267 Identity:116/267 - (43%)
Similarity:171/267 - (64%) Gaps:1/267 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 EEFACGCGAAFVNIAVTYPIYKMIFRQMLHGVPITSAFAQLRHEGLGFLYRGMLPPLAQKTISLS 119
            :.:.||..|||.|||:|:||.|::|||.|:||....|..||:.:|:..||||:||||.|||.:|:
 Frog    51 KHYICGYFAAFTNIAITFPIQKVLFRQQLYGVRTRDAVRQLQTDGIRNLYRGILPPLMQKTTTLA 115

  Fly   120 IMFGVFDGTRRYLVEDYRLNDYGAKVLAAVVAGSAESILLPFERVQTLLADSKFHQHFSNTQNAF 184
            :|||:::.....|:......:...:.:||::||:.|::|.|||||||||.|.|.|..|:||..||
 Frog   116 LMFGLYEDFSSLLLR
HTNSPEVVTRSVAAILAGTTEALLTPFERVQTLLQDYKHHDRFTNTFQAF 180

  Fly   185 RYVVSHHGYRELYRGLEPVFWRNGLSNALFFVLREEASVRLPKRKSVSTRTVQEFIAGAVIGASI 249
            : |:..:|.||.||||.|:..|||.||||||.||......||:.|:.|...:.:||.|.::||.:
 Frog   181 K-VLRPYGIREYYRGLVPILLRNGPSNALFFGL
RSPIKQCLPEAKTYSANLINDFICGGLLGAML 244

  Fly   250 STIFYPLNVIKVSLQSEMGQRSEGSWQACKRIYVERDRRIGNFYRGCPFNTGRSFISWGIMNTAY 314
            ..:|:|:||:|..:||::|.......:....|:.|||.::.:.:||...|..||.:||||:|..|
 Frog   245 GFLFFPINVVKARMQSQIGGEFISFGKVLMIIWTERDGKLTHLFRGAHLNYHRSILSWGIINATY 309

  Fly   315 ENLKKLM 321
            |.|.|::
 Frog   310 ELLLKVL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 38/80 (48%)
Mito_carr 141..229 CDD:278578 45/87 (52%)
Mito_carr 235..322 CDD:278578 31/87 (36%)
slc25a51XP_012809330.1 Mito_carr 47..130 CDD:365909 38/78 (49%)
Mito_carr 137..212 CDD:365909 41/75 (55%)
Mito_carr 229..316 CDD:365909 31/86 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H88487
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D503015at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3422
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.