DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and AT1G02030

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_171705.1 Gene:AT1G02030 / 839285 AraportID:AT1G02030 Length:267 Species:Arabidopsis thaliana


Alignment Length:272 Identity:62/272 - (22%)
Similarity:90/272 - (33%) Gaps:77/272 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CFFCGAVDLSDTGSSSSMRYETLSAKVPSSQKTVSLVLTHLANCIQ-----TQLDLKPG---ARL 60
            |..|.....:.......||...|...:||..::.|..:......:|     |:...||.   :||
plant     7 CKLCWKSFANGRALGGHMRSHMLIHPLPSQPESYSSSMADPGFVLQDRESETESSKKPSRKRSRL 71

  Fly    61 CPRCFQELSDYDTIMVNLMTTQKRLTTQLKGALKSEFEVPESGEDILVEEVEIPQSDVETDADAE 125
            ..|....|..        ..:.:...::...|...:..|.|..|....:|   |.|.|...|..|
plant    72 NRRSISSLRH--------QQSNEEGKSETARAADIKIGVQELSESCTEQE---PMSSVSDAATTE 125

  Fly   126 AD-ALFVELVKDQEESDTEIKREFVDEEEEEDDDDDDEFICEDVDVGDSEALYGKSSDGEDRPTK 189
            .| ||.:.|          :.|:..::||||.|                          |:|..|
plant   126 EDVALSLML----------LSRDKWEKEEEESD--------------------------EERWKK 154

  Fly   190 KRVKQ-ECTTCGKVYNSWYQL-------QKHISE-------------EHSKQPNHICPICGVIRR 233
            ||.|. ||.||.||:.|:..|       :|.|:|             :.|...:|.||||..:..
plant   155 KRNKWFECETCEKVFKSYQALGGHRASHKKKIAETDQLGSDELKKKKKKSTSSHHECPICAKVFT 219

  Fly   234 DEEYLELHMNLH 245
            ..:.|..|...|
plant   220 SGQALGGHKRSH 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 14/61 (23%)
C2H2 Zn finger 225..245 CDD:275368 6/19 (32%)
C2H2 Zn finger 253..273 CDD:275368
C2H2 Zn finger 281..301 CDD:275368
C2H2 Zn finger 310..327 CDD:275370
zf-C2H2 337..359 CDD:278523
C2H2 Zn finger 339..359 CDD:275368
AT1G02030NP_171705.1 zf-C2H2_6 4..28 CDD:404748 4/20 (20%)
zf-C2H2_6 160..185 CDD:404748 8/24 (33%)
zf-C2H2_6 208..231 CDD:404748 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2552
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.