DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and AT3G60580

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_191617.1 Gene:AT3G60580 / 825229 AraportID:AT3G60580 Length:288 Species:Arabidopsis thaliana


Alignment Length:284 Identity:62/284 - (21%)
Similarity:99/284 - (34%) Gaps:104/284 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SSMRYET---LSAKVPSSQKTVSLVLTHLANCIQTQLDLKPGARLCPRCFQELSDYDTIMVNLMT 80
            |.:.|||   :|:..|....|.|::             |:.|        :..|:....::||..
plant    38 SQLSYETESDVSSSDPKFAFTSSVL-------------LEDG--------ESESESSRNVINLTR 81

  Fly    81 TQKRLTTQLKGALKSEFEVPESGEDILVEEVEIPQSDVE------TDADAEADALF--VELVKD- 136
            .:.:.|.:|...:..:.:..:.|..        |:||.|      :|...|.|..|  :.|.:| 
plant    82 KRSKRTRKLDSFVTKKVKTSQLGYK--------PESDQEPPHSSASDTTTEEDLAFCLMMLSRDK 138

  Fly   137 --QEESDTEIKREFVDEEEEEDDDDDDEFICEDVDVGDSEALYGKSSDGEDRPTKKRVKQECTTC 199
              :.:|:.|:..|...|||.|.                    |.|.:..   .||.|.|  |.||
plant   139 WKKNKSNKEVVEEIETEEESEG--------------------YNKINRA---TTKGRYK--CETC 178

  Fly   200 GKVYNSWYQLQKH--------ISEEHSKQPN--------------HICPIC----------GVIR 232
            |||:.|:..|..|        :|...::|.:              |.||||          |..:
plant   179 GKVFKSYQALGGHRASHKKNRVSNNKTEQRSETEYDNVVVVAKRIHECPICLRVFASGQALGGHK 243

  Fly   233 RDEEYLELHMN----LHEGKTEKQ 252
            |......|.:|    :|..::.||
plant   244 RSHGVGNLSVNQQRRVHRNESVKQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 17/84 (20%)
C2H2 Zn finger 225..245 CDD:275368 8/33 (24%)
C2H2 Zn finger 253..273 CDD:275368 62/284 (22%)
C2H2 Zn finger 281..301 CDD:275368
C2H2 Zn finger 310..327 CDD:275370
zf-C2H2 337..359 CDD:278523
C2H2 Zn finger 339..359 CDD:275368
AT3G60580NP_191617.1 zf-C2H2_6 4..28 CDD:290623
zf-C2H2_6 172..197 CDD:290623 11/26 (42%)
zf-C2H2_6 223..246 CDD:290623 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2552
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.