DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and DAZ1

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_179309.1 Gene:DAZ1 / 816223 AraportID:AT2G17180 Length:270 Species:Arabidopsis thaliana


Alignment Length:247 Identity:47/247 - (19%)
Similarity:75/247 - (30%) Gaps:76/247 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 DVGDSEALYGKSSDGEDRPTKKRVKQECTTCGKVYNSWYQLQKHISEEHSKQPNHICPICGVIRR 233
            :||.|.:........:..|...::.:.||.|||.:.|...|..|:.....:|...|.|       
plant    40 EVGSSSSSPRPKPVTQPDPDASQIARPCTECGKQFGSLKALFGHMRCHPERQWRGINP------- 97

  Fly   234 DEEYLELHMNLHEGKTEKQCRYCPKSFSRPVNT-LRHMRMHWD--KKKYQCEKCGLRFSQDNLLY 295
                                   |.:|.|.:|: .......||  ::::....|.|..:..::  
plant    98 -----------------------PSNFKRRINSNAASSSSSWDPSEEEHNIASCLLMMANGDV-- 137

  Fly   296 NHRLRHEAEENPIICSICNVSFKSRKTFNHHTLIHK------------ENRP------------- 335
              ..|....|....|..|...|.|.:....|...||            |:.|             
plant   138 --PTRSSEVEERFECDGCKKVFGSHQALGGHRATHKDVKGCFANKNITEDPPPPPPQEIVDQDKG 200

  Fly   336 ---------RHYCSVCPKSFTERYTLKMHMKTH-----EGDVVYGVREEAPA 373
                     .|.|::|.:.|:....|..||:.|     |.:.|.|:....||
plant   201 KSVKLVSGMNHRCNICSRVFSSGQALGGHMRCHWEKDQEENQVRGIDLNVPA 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 33/196 (17%)
C2H2 Zn finger 225..245 CDD:275368 1/19 (5%)
C2H2 Zn finger 253..273 CDD:275368 4/20 (20%)
C2H2 Zn finger 281..301 CDD:275368 2/19 (11%)
C2H2 Zn finger 310..327 CDD:275370 4/16 (25%)
zf-C2H2 337..359 CDD:278523 7/21 (33%)
C2H2 Zn finger 339..359 CDD:275368 6/19 (32%)
DAZ1NP_179309.1 zf-C2H2_6 64..89 CDD:290623 8/24 (33%)
zf-C2H2_6 147..173 CDD:290623 7/25 (28%)
zf-C2H2_6 211..236 CDD:290623 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2552
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.