DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and dati

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001245421.1 Gene:dati / 43789 FlyBaseID:FBgn0262636 Length:1150 Species:Drosophila melanogaster


Alignment Length:474 Identity:91/474 - (19%)
Similarity:154/474 - (32%) Gaps:130/474 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GSSSSMRYETLSAKVPSSQKTVSLVLTHLANCIQTQLDLKP-------------GARLCPRCFQE 67
            |:.|::..:...:..||.|      |......:||. ..||             |.|..|     
  Fly   276 GAPSTVSTDDAQSSAPSHQ------LAGTGRALQTH-QCKPMSPGTVGSSNLGAGRRSAP----- 328

  Fly    68 LSDYDTIMVNLMTTQ---KRLTTQLKGALKSEFEVPESGEDILVEEVEIPQSDVETDADAEADAL 129
                .||.......|   :..||...|:...:.:.   ..|.:..|:::..|...:.|......|
  Fly   329 ----TTISKTFSQGQQSPQHSTTPSGGSTTPDIKY---NNDKMANEIQLQLSRSSSAAAISERTL 386

  Fly   130 FVELVKDQEESDTEIKREFVDEEEEEDDDDDDEFICEDVDVGDSEALYGKSSDGEDRPTKKRVKQ 194
                    ||..:.::|.|:.:...:.....    ...|.:|........:..|...|:......
  Fly   387 --------EECWSTLQRLFMHKSAMQQIQQQ----IPRVGLGTHGVTGSANLGGSITPSSDTKPH 439

  Fly   195 ECTTCGKVYNSWYQLQKHISEEHSKQPNHICPICGVIRRDEEYLELHMNLHEGKTEKQCRYCPKS 259
            :|..|.|.::|.:||.:||                             .:|.|:...:|.||.:.
  Fly   440 QCQQCMKSFSSNHQLVQHI-----------------------------RVHTGEKPYKCSYCDRR 475

  Fly   260 FSRPVNTLRHMRMHWDKKKYQCE--KCGLRFSQDNLLYNHRLRHEAE-----ENPIICSICNVSF 317
            |.:..:..:|.|:|..::.|:|.  .||..|.|.:.|..|...|:|:     ..|..|:||...|
  Fly   476 FKQLSHVQQHTRLHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNICGKGF 540

  Fly   318 KSRKTFNHHT----LIHKENRPRH----------YCSVCPKSFTERYTLKMHMK-THE------- 360
            .:..:...||    .:|.....:|          .|.||.|.|.....|..||| .|:       
  Fly   541 ATESSLRTHTSKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHVHKEKSPPPG 605

  Fly   361 ----------GDVVYGVREEAPADEQQVVEELHVDVDESEAAVTVIMSDNDENSGF--------- 406
                      ..:|.|......:..:|:..:...:.:..:|.|...:.|:     |         
  Fly   606 GSASSQFSELNQIVTGNGNGTGSSNEQIATQCTTESNSHQATVGSSLIDS-----FLGKRRTANH 665

  Fly   407 -CLICNTNFENKKELEHHL 424
             |.:|..::.|:..|..||
  Fly   666 PCPVCGKHYVNEGSLRKHL 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 42/176 (24%)
C2H2 Zn finger 225..245 CDD:275368 0/19 (0%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
C2H2 Zn finger 281..301 CDD:275368 7/21 (33%)
C2H2 Zn finger 310..327 CDD:275370 4/16 (25%)
zf-C2H2 337..359 CDD:278523 10/32 (31%)
C2H2 Zn finger 339..359 CDD:275368 9/20 (45%)
datiNP_001245421.1 COG5048 <429..>511 CDD:227381 24/110 (22%)
C2H2 Zn finger 441..461 CDD:275368 8/48 (17%)
zf-H2C2_2 454..478 CDD:290200 9/52 (17%)
C2H2 Zn finger 469..489 CDD:275368 6/19 (32%)
zf-H2C2_2 481..508 CDD:290200 8/26 (31%)
C2H2 Zn finger 497..519 CDD:275368 7/21 (33%)
C2H2 Zn finger 533..557 CDD:275368 6/23 (26%)
C2H2 Zn finger 576..594 CDD:275368 7/17 (41%)
C2H2 Zn finger 667..687 CDD:275370 6/18 (33%)
C2H2 Zn finger 702..719 CDD:275370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.