DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and CG4936

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster


Alignment Length:493 Identity:104/493 - (21%)
Similarity:159/493 - (32%) Gaps:204/493 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SQKTVSLVLTHLANCIQTQLDLKPGARLCPRCFQELS-----------DYDTI--MVNLMTTQKR 84
            |:|.::.::.........|.|..|. ::|.:||:.|.           .|..:  .|..:..::|
  Fly    42 SEKDLTHMIRECGGVPIKQFDHYPD-KICEKCFKVLKMAFKFRETCQRSYGHLRQFVGPVEVEQR 105

  Fly    85 LTTQLKG---ALKSEFEV-PESGEDILVEEVEIPQSDVETDAD----AEA--------------- 126
             ..:.||   |.|.|.:| |:..|    :|.|..:.|.:.|.|    |||               
  Fly   106 -PPEKKGSETATKLEPDVDPDEAE----QEPEHDEEDEDVDLDESHYAEADDAAETQGGVFHDEI 165

  Fly   127 -DALFVELVKD--------QEESDTEIKR----------------------------------EF 148
             |.:.|||.||        |.|.|..|:.                                  |:
  Fly   166 EDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVYETYEGDLIPDQGYDHEMADQALSELSAEIEY 230

  Fly   149 VDEEE--------EEDDDD------DDEFIC---------------------------------- 165
            :|:.|        .|||.:      ::||:.                                  
  Fly   231 LDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSVRASIHARNATKRRVNPRRSATSTASVAVES 295

  Fly   166 -------------------------------EDVDVGDSEALYGKSSDGEDR-------PTKKRV 192
                                           :|:.:|  |.|..|.|..:.:       ..||..
  Fly   296 STSKTTDRGNPLKVRRGNSDSAGSKMSIKSEKDISIG--EVLARKHSGIKTKGGHKILLGDKKEF 358

  Fly   193 KQECTTCGKVYNSWYQLQKHISEEHSKQPNHICPICGVIRRDEEYLELHMNLHEGKTEKQCRYCP 257
            |..|..||.:|.|..:|.:|| :.||....|.|.|||......:.|..|||.|.|....:|.|||
  Fly   359 KYICDVCGNMYPSQSRLTEHI-KVHSGVKPHECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCP 422

  Fly   258 KSFSRPVNTLRHMRMHWDKKKYQCEKCGLRFSQDNLLYNHRLRHEAEENPIICSICNVSFKSRKT 322
            .:|:......:|.|:|.:::.|:|:                             :|:.:|....|
  Fly   423 AAFADLSTRNKHHRIHTNERPYECD-----------------------------VCHKTFTYTNT 458

  Fly   323 FNHHTLIHKENRPRHYCSVCPKSFTERYTLKMHMKTHE 360
            ...|.:||...:| |.|.||.|.|.:.|.|:.|...||
  Fly   459 LKFHKMIHTGEKP-HVCDVCGKGFPQAYKLRNHRVIHE 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 43/154 (28%)
C2H2 Zn finger 225..245 CDD:275368 8/19 (42%)
C2H2 Zn finger 253..273 CDD:275368 7/19 (37%)
C2H2 Zn finger 281..301 CDD:275368 1/19 (5%)
C2H2 Zn finger 310..327 CDD:275370 3/16 (19%)
zf-C2H2 337..359 CDD:278523 9/21 (43%)
C2H2 Zn finger 339..359 CDD:275368 8/19 (42%)
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 10/53 (19%)
C2H2 Zn finger 362..382 CDD:275368 8/20 (40%)
zf-H2C2_2 375..399 CDD:290200 10/24 (42%)
COG5048 386..>447 CDD:227381 20/60 (33%)
C2H2 Zn finger 390..410 CDD:275368 8/19 (42%)
zf-H2C2_2 403..426 CDD:290200 10/22 (45%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
zf-H2C2_2 432..455 CDD:290200 7/51 (14%)
C2H2 Zn finger 446..466 CDD:275368 5/48 (10%)
zf-H2C2_2 459..481 CDD:290200 9/22 (41%)
C2H2 Zn finger 474..494 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2552
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.