DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and CG17803

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster


Alignment Length:537 Identity:106/537 - (19%)
Similarity:180/537 - (33%) Gaps:163/537 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FCGAVDLSDTGSSSSMRYETLSAKVPSSQKTVSLVLTHLANCIQTQLDLKPGARLCPRCFQELSD 70
            |....|.||...::|...:|.:|.............|.|..|     |..|.:: |..||:.:|.
  Fly    37 FLAEADDSDATCTTSTALDTTTADSAFFDSDFEEESTGLQEC-----DPPPASK-CRTCFRIISR 95

  Fly    71 -------YDTIMVNLM----------------------------TTQK---------------RL 85
                   ||.:.:.|:                            |..|               |.
  Fly    96 HEDAQDLYDRVNIALLHHIKVITGVWIQQGVKELPHHICSTCQETVNKSMEFRAKCQQVDKKLRQ 160

  Fly    86 TTQLKGALKSEFEVPESGEDILVEEVE----------------IPQSDVETDAD---AEADALFV 131
            ||:.......:.|:....|::|.||..                :|.|:...|.|   .:|:....
  Fly   161 TTEKYNIQICDEEMESELENVLYEESAQQAKGVVGLEDFSSELLPDSEGVLDEDDFPLDAEPTQF 225

  Fly   132 ELVKDQEESDTEIKREFVDEE---------------EEEDDDDDDEFICEDVDVGDSEAL----- 176
            .|.:|:.:.|.:.:::|..|:               :||....|.......|.:|:..:|     
  Fly   226 SLSEDELDLDRDTEKDFALEQNKSCNEIISIRKCKTKEEIGKVDHGAKVYKVVLGEYNSLKETAP 290

  Fly   177 -YG----------KSSDGEDRPTKKRVKQE-----CTTCGKVYNSWYQLQKHISEEHSKQPNHIC 225
             |.          .|.:.::|..::|::.:     |..||..:....|||.|:. .|::..|..|
  Fly   291 KYSLSLPKKPQLRVSPEEKNRRRRERIQAKPLNYVCDKCGHTFRQRSQLQMHLL-RHNRAKNFEC 354

  Fly   226 PIC-----GVIRRDEEYLELHMNLH---------------------------------------E 246
            |.|     .:..|:.....||...|                                       |
  Fly   355 PECPKKFYDLYTRNIHVRALHKGEHPFPCNHCNESFANASSRHRHERDVHGAGNRIRTRVKSKEE 419

  Fly   247 GKTEKQCRYCPKSFSRPVNTLRHMRMHWDKKKYQCEKCGLRFSQDNLLYNHRLRHEAEENPIICS 311
            |.:...|..|.||::.....:.||..|...:.:||:.|.::|:..:.:..|:..|  ::.||.|.
  Fly   420 GSSRHYCTQCTKSYTSKKGLVLHMNFHNGSRPFQCKICQMKFADPSAMKRHQALH--DKFPIRCD 482

  Fly   312 ICNVSFKSRKTFNHHTLIHKENRPRHYCSVCPKSFTERYTLKMHMKT--HEGDVVYGVREEAPAD 374
            ||...|..|.....|..:|....| |.|.:|...:..||.|..|..|  |..::...::||... 
  Fly   483 ICLKGFLLRSQLTKHQDVHTGMHP-HRCEICDVHYRHRYNLNKHKNTDLHRDNMQKAIKEEVNG- 545

  Fly   375 EQQVVEELHVDVD-ESE 390
            .||..:::..::| ||:
  Fly   546 LQQAFKDIDKEMDFESQ 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 46/200 (23%)
C2H2 Zn finger 225..245 CDD:275368 6/24 (25%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
C2H2 Zn finger 281..301 CDD:275368 4/19 (21%)
C2H2 Zn finger 310..327 CDD:275370 5/16 (31%)
zf-C2H2 337..359 CDD:278523 8/23 (35%)
C2H2 Zn finger 339..359 CDD:275368 7/21 (33%)
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 9/73 (12%)
COG5048 <323..528 CDD:227381 48/208 (23%)
zf-C2H2 324..346 CDD:278523 7/22 (32%)
C2H2 Zn finger 326..346 CDD:275368 7/20 (35%)
C2H2 Zn finger 354..375 CDD:275368 4/20 (20%)
C2H2 Zn finger 383..401 CDD:275368 0/17 (0%)
C2H2 Zn finger 426..446 CDD:275368 6/19 (32%)
C2H2 Zn finger 454..474 CDD:275368 4/19 (21%)
C2H2 Zn finger 481..501 CDD:275368 6/19 (32%)
C2H2 Zn finger 509..528 CDD:275368 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455485
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.