DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and CG3281

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster


Alignment Length:446 Identity:109/446 - (24%)
Similarity:161/446 - (36%) Gaps:123/446 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TCFFCGAVDLSDTGSSSSMRYETLSAKVPSSQKTVSLVLTHLANCIQTQLDLKPGARLCPRCFQE 67
            ||..|.....::......::|..|..::....:.||.:.       .|..|......||..|   
  Fly    14 TCRVCLETHETNLYVHDEIKYNDLKLELWQLLEAVSKLK-------WTWTDPNLPMHLCQNC--- 68

  Fly    68 LSDYDTIMVNLMTTQKRLTTQLKGALKSEFEVPESGEDI--LVEEVEIPQSDVETDADAEADALF 130
                              ..:|.||.:...||..:.|.:  |.|:.|:.....|...|.      
  Fly    69 ------------------ARRLIGAYEFIVEVENAHETLQNLFEQQEVAAKPDEVHVDV------ 109

  Fly   131 VELVKDQEE-------SDTEIKREFVDEEEEEDDDDDDEFICEDVDVGDSEALYGKSSDGEDRP- 187
            |||: ||::       ..|....:.|:.||:..|.|...|..   |||: |.||. |.|.:|.| 
  Fly   110 VELI-DQDDVVSMAQYLSTSFAEQHVEMEEKYGDQDCSAFTS---DVGE-EPLYA-SEDRDDEPE 168

  Fly   188 ----TKKRVKQ------------------------ECTTCGKVYNSWYQLQKHISEEHS------ 218
                .|.|..:                        :|..|.:|:.....|.:|.|:.|.      
  Fly   169 DSFQLKPRPDEIENRELSRPSQLGSRLNHSANFIYKCAVCPRVFAKSESLTRHFSQAHKLTADVA 233

  Fly   219 --KQPNH-------ICPICGVIRRDEEYLELHMN-LH--------EGKTE----------KQCRY 255
              |..|.       .|..|....:.::.|..||. .|        |..|:          :.|.:
  Fly   234 AMKLANESCGTGLLTCEHCPRTFKRQDTLRRHMQAFHPDAIALEPEETTDNSARKRIAKRRDCPH 298

  Fly   256 CPKSFSRPVNTLR-HMRMHWDKKKYQCEKCGLRF--SQDNLLYNHRLRHEAEENPIICSICNVSF 317
            |..||  ||::|. |:|.|.....|:|::|...|  |||..|:   :|....|.|..|.||:..|
  Fly   299 CGLSF--PVSSLTIHIRRHTGDNPYKCDQCEKAFPRSQDLSLH---MRQHTGERPSECKICSKKF 358

  Fly   318 KSRKTFNHHTLIHKENRPRHYCSVCPKSFTERYTLKMHMKTHEGDVVY--GVREEA 371
            .|:.....|..:|...|| :.|.:|.|||.:...||:||:.|.|:..|  ||..|:
  Fly   359 ISQNKLARHMRLHTGQRP-YSCKMCSKSFVQSNDLKIHMRRHTGERPYQCGVCGES 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 53/191 (28%)
C2H2 Zn finger 225..245 CDD:275368 5/20 (25%)
C2H2 Zn finger 253..273 CDD:275368 9/20 (45%)
C2H2 Zn finger 281..301 CDD:275368 7/21 (33%)
C2H2 Zn finger 310..327 CDD:275370 5/16 (31%)
zf-C2H2 337..359 CDD:278523 9/21 (43%)
C2H2 Zn finger 339..359 CDD:275368 9/19 (47%)
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 18/105 (17%)
C2H2 Zn finger 205..226 CDD:275368 6/20 (30%)
C2H2 Zn finger 249..266 CDD:275368 3/16 (19%)
COG5048 <294..>391 CDD:227381 35/102 (34%)
C2H2 Zn finger 296..315 CDD:275368 9/20 (45%)
zf-H2C2_2 307..330 CDD:290200 7/22 (32%)
C2H2 Zn finger 323..343 CDD:275368 8/22 (36%)
zf-H2C2_2 335..358 CDD:290200 8/25 (32%)
C2H2 Zn finger 351..371 CDD:275368 6/19 (32%)
zf-H2C2_2 364..388 CDD:290200 9/24 (38%)
C2H2 Zn finger 379..399 CDD:275368 9/19 (47%)
zf-H2C2_2 391..416 CDD:290200 10/23 (43%)
C2H2 Zn finger 407..424 CDD:275368 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.