DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and CG6254

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster


Alignment Length:429 Identity:99/429 - (23%)
Similarity:170/429 - (39%) Gaps:104/429 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GAVDLSDTGSSSSMRYETL--SAKVPSSQKTVSLVLTHLANCIQTQLDLKPGARLCPRCFQELSD 70
            ||||            |:|  :.:|..|::...:..|..::.:::::.:.|...:..:|.||..|
  Fly   130 GAVD------------ESLPQNDEVFISEEQPIVCQTETSSKMKSEILMIPNFLVEKQCLQEKQD 182

  Fly    71 YDTIMVNLMTTQKRLTTQLKGALKSEFEVPESGEDILVEEVE--IPQSDVETDADAEADALFVEL 133
            :               .:.:..::.|.::....|:||.|:||  :.:.:||| .:.|.|.:..|:
  Fly   183 F---------------PKEEDVIEEEMQISGVEEEILEEDVEEDLAEEEVET-VEEEIDTVGEEV 231

  Fly   134 VKDQEESDTEIKREFVDEEEEEDDDD---DDEFICEDVDVGD--------------SEALYGKS- 180
            ...:||.:|:...:.:.||.|...:|   ::..|.|:..|.|              .|.:..|. 
  Fly   232 EAVEEELETQDATDCLVEEVEHMTEDRYIEESQIIEESQVSDFNMETYEIVQHNPQKEPVETKDT 296

  Fly   181 -------------------SDGEDRPTKKRVKQECTTCGKVYNSWYQLQKHISEEHS----KQPN 222
                               :|.||..::.....:|..|.|.|......::|:.|.|:    ..|.
  Fly   297 VESIESNEDTQEDISREHVTDEEDEISEVPAMYKCNICKKPYKKPKAYKRHMEEVHNTVADDLPQ 361

  Fly   223 HICPICGVIRRDEEYLELHMNLH---EGKTEKQCRYCPKSFSRPVNTLRHMR-MHWDKKKYQCEK 283
            ..|..|.:.......|..|...|   :.||:..|.:|.|.|:......||:. :|...|.|.|:.
  Fly   362 LECNQCKLCFPTVAQLHAHHRTHVRAKPKTDNCCPHCEKRFTTSGTLKRHIEGIHNQIKPYVCDL 426

  Fly   284 CGLRFSQDNLLYNHRLRHEAE---ENPII-----------------------CSICNVSFKSRKT 322
            ||..|:....|.:|:|.|..|   |.|:.                       |::|.:..|:|:|
  Fly   427 CGKSFNYITGLKDHKLVHTDECPFECPVCKRGFKNNARLKIHLDTHSAEIYECTVCGLKLKTRRT 491

  Fly   323 FNHHTLIHKENRPRHYCSVCPKSFTERYTLKMHMKTHEG 361
            ||.|.|:|.:.| :..|.||..:|....|||.|:..|.|
  Fly   492 FNKHKLVHSDTR-QFKCEVCGSAFKRSKTLKAHLILHTG 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 50/188 (27%)
C2H2 Zn finger 225..245 CDD:275368 4/19 (21%)
C2H2 Zn finger 253..273 CDD:275368 6/20 (30%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
C2H2 Zn finger 310..327 CDD:275370 7/16 (44%)
zf-C2H2 337..359 CDD:278523 8/21 (38%)
C2H2 Zn finger 339..359 CDD:275368 8/19 (42%)
CG6254NP_649983.2 zf-AD 21..99 CDD:285071
COG5048 <353..554 CDD:227381 49/178 (28%)
C2H2 Zn finger 364..384 CDD:275368 4/19 (21%)
C2H2 Zn finger 395..416 CDD:275368 6/20 (30%)
C2H2 Zn finger 424..444 CDD:275368 7/19 (37%)
C2H2 Zn finger 452..472 CDD:275368 1/19 (5%)
C2H2 Zn finger 479..499 CDD:275368 9/19 (47%)
C2H2 Zn finger 507..527 CDD:275368 8/19 (42%)
zf-H2C2_2 520..544 CDD:290200 5/10 (50%)
C2H2 Zn finger 535..553 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2552
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.