DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and CG8478

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001163576.1 Gene:CG8478 / 41194 FlyBaseID:FBgn0037746 Length:576 Species:Drosophila melanogaster


Alignment Length:463 Identity:83/463 - (17%)
Similarity:143/463 - (30%) Gaps:171/463 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AVDLSDTGSSSSMRYE-------TLSAKVPSSQKTVSLVLTHLANCIQT------QLDLKPGARL 60
            ::||:......:.:.|       |||:.|..:..||.      ||.::|      .:.|:..|:.
  Fly   133 SIDLTQIDDKENTQPEGCGGDNSTLSSSVDVTANTVK------ANTLKTGDATMDNVSLQEAAKT 191

  Fly    61 -CPRCFQELSDYDTIMVNLMTTQKRLTTQLKGALKSEFEVPESGEDILVEEV-EIPQSDVETDAD 123
             .|.....|| .:.::.|:........:.|.....:|.||....|  :|.|| |:....::..||
  Fly   192 PAPSQVYPLS-ANVVLENITEVSNEGVSMLVSPAGAEKEVAHVNE--VVNEVSELIAKALKISAD 253

  Fly   124 AEADA---LFVELVKDQEESDTEIKREFVDEEEEEDDDDDDEFICEDVDVGDSEALYGKSSDGED 185
            :...|   |.||..|.::...:......:......                     |..::..|.
  Fly   254 SVKPATSKLKVEAGKKRQSMSSTYSGAALPRPRRS---------------------YLPTTTAET 297

  Fly   186 R------------------PTKKR--------VKQECTTCGKVYNSWYQLQKHISEEHSKQPNHI 224
            |                  |.:||        .::.|....|:..|  .::|.::....:.|..|
  Fly   298 RTYSFKQRMSVVVKTTLNSPARKRSVGGGVSLSRRSCLPVSKLTKS--SIRKSLAVTSVRSPEKI 360

  Fly   225 ------------------CPICGVIRRDEEYLELHMNLHE-------------------GKTEKQ 252
                              |..|....|.:..|::||.:|:                   |.::.:
  Fly   361 ASKPAKTSTKSIPEKVFSCKNCSTTFRVKSLLDVHMRMHDPVDNGANTLKRLNSNPVAAGVSKNR 425

  Fly   253 CRYCPKSFSRPVNTLRHMRMHWDK-----------------KKYQCEKCG--------------- 285
            |::|.|:|:.......|:..:.||                 ||.|..|.|               
  Fly   426 CKFCDKNFALERALHIHLMQNCDKIPPSEKRKLEFTELNHEKKAQLPKIGGTSGINHPMTMPQKP 490

  Fly   286 ---------LRFSQ--------------DNLLYNHRLRHEAEENPIICSICNVSFKSRKTFNHHT 327
                     |..||              .|:.:....|...:..|  |.||..||:|...|.:|:
  Fly   491 QQRISTIPKLAPSQGTQSMAPPSVKKIPKNVAHAGVYRTPTKTVP--CHICKQSFRSILEFTNHS 553

  Fly   328 L-IHKENR 334
            | :|..|:
  Fly   554 LTVHGNNQ 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 41/223 (18%)
C2H2 Zn finger 225..245 CDD:275368 6/19 (32%)
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
C2H2 Zn finger 281..301 CDD:275368 6/57 (11%)
C2H2 Zn finger 310..327 CDD:275370 7/16 (44%)
zf-C2H2 337..359 CDD:278523
C2H2 Zn finger 339..359 CDD:275368
CG8478NP_001163576.1 zf-C2H2 377..399 CDD:278523 6/21 (29%)
C2H2 Zn finger 379..399 CDD:275368 6/19 (32%)
C2H2 Zn finger 426..444 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.