DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and pzg

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001262143.1 Gene:pzg / 40351 FlyBaseID:FBgn0259785 Length:996 Species:Drosophila melanogaster


Alignment Length:399 Identity:76/399 - (19%)
Similarity:153/399 - (38%) Gaps:48/399 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LCPRCFQELSDYDTIMVNLMTTQKRLTTQLKGALKSEFEVPES-GED----ILVEEVEIPQSDVE 119
            :|.||...::.||    .|....:|:.|.|...|..::.:.|. |::    :.::::....::..
  Fly   130 VCSRCTNLVNYYD----RLENDVERVKTNLISLLNKKYAINEDMGQEGSPPLKMQKMVGGSANRS 190

  Fly   120 TDADAEADALFV-ELVKDQEESDTEI----KREFVDEEEEEDDDDDDEFICEDVDVGDSEALYGK 179
            .:....||.|.. :|::......::|    .:..|...:.........:.|...|.        |
  Fly   191 LEESPSADLLRPRKLLQGNPVGQSKIAPGTTQSSVQGTQTVQRKATKIYKCTSCDY--------K 247

  Fly   180 SSD----GEDRPTKKRVKQECTTCGKVYNSWYQLQKHISEEHSKQPNHICPICGVIRRDEEYLEL 240
            :||    .....|.|:...:|.||.|::..:..:::|:..:|:...::.|.:|.:...:|..|..
  Fly   248 TSDMRLFNTHYETCKQQTFQCKTCRKIFPHFGAMKQHMVRDHNTAMDNTCAMCHINFVNENSLRK 312

  Fly   241 HMN-------LHEGKTEKQCRYCPKSFSRPVNTLRHMRMHWDKKKYQCEKCGLRFSQDNLLYNHR 298
            ||.       |....|.......|.:.:.................|.|..|..: |.|.::::..
  Fly   313 HMETNHATNVLVTSTTTIPASAAPVAAAAAAAAAAANENLVGTSLYTCNHCQFK-STDKVVFDEH 376

  Fly   299 LRHEA--EENPIICSICNVSFKSRKTFNHHTLIHKENRPRHYCSVCPKSFTERYTLKMHMKTHEG 361
            :|..|  :..|..|.:|:..|::|:....|...|:.|..:  |..|..:|.:|..|..|.:.|:.
  Fly   377 MRKHAAGKPKPFKCRLCSQRFETREAATVHAKQHQTNFFK--CGTCSMTFPKREMLVKHFEVHQS 439

  Fly   362 DVVYGVREEAPADE--------QQVVEELHVDVDESEAAVTVIMSDNDENSGF--CLICNTNFEN 416
            .....|..:....:        |:.::|...|...:..|..|..::::.|..|  |.||:..|..
  Fly   440 PSASTVSPKQSVSQNLNTQKLLQETIDEALSDSLPASTAAVVATTESENNIRFFSCSICSLTFIQ 504

  Fly   417 KKELEHHLQ 425
            :....||::
  Fly   505 ETYYNHHME 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 32/163 (20%)
C2H2 Zn finger 225..245 CDD:275368 6/26 (23%)
C2H2 Zn finger 253..273 CDD:275368 1/19 (5%)
C2H2 Zn finger 281..301 CDD:275368 4/19 (21%)
C2H2 Zn finger 310..327 CDD:275370 4/16 (25%)
zf-C2H2 337..359 CDD:278523 6/21 (29%)
C2H2 Zn finger 339..359 CDD:275368 6/19 (32%)
pzgNP_001262143.1 C2H2 Zn finger 241..263 CDD:275371 6/29 (21%)
C2H2 Zn finger 268..289 CDD:275371 5/20 (25%)
C2H2 Zn finger 297..318 CDD:275371 6/20 (30%)
C2H2 Zn finger 360..380 CDD:275368 5/20 (25%)
zf-H2C2_2 373..399 CDD:290200 6/25 (24%)
zf-C2H2_8 375..443 CDD:292531 17/69 (25%)
C2H2 Zn finger 390..410 CDD:275368 5/19 (26%)
C2H2 Zn finger 417..437 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455448
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.