DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and CG10654

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster


Alignment Length:437 Identity:85/437 - (19%)
Similarity:146/437 - (33%) Gaps:139/437 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GAR--LCPRCFQELSDYDTIMVNLMTTQKRLTTQLKGALKSEFEVPESGEDILVEEVEIPQSDVE 119
            ||:  :|..|...|...|.  .:.:.:::.|.::..|.         :|||.:   .::|...| 
  Fly    34 GAKTMICRACLVLLGPQDA--CHNLDSEQDLASKYYGC---------TGEDAV---RDLPPQLV- 83

  Fly   120 TDADAEADALFVELVKDQEESDTEIKREFVDEEEEEDDDDDDEFICEDVDVGDSEALYGKSSDGE 184
            ..:..|.....|:...|.:....|..|.|             |.:.:|:|:|             
  Fly    84 LKSICECCYQLVQKFHDFQRMCAESLRNF-------------EKLLQDIDIG------------- 122

  Fly   185 DRPTKKRVKQECTTCGKVY-NSWYQLQKHISEEHSKQPN--------------------HIC-PI 227
                          |.|:. ::|:.|........|..|.                    .:| |:
  Fly   123 --------------CHKLEDHTWHDLDTPSESNESTNPEAQSHAPCIAATQEIVSFIWPQVCLPL 173

  Fly   228 CGVIRR---------------DE--------EYLELHMNLHEGKTEK------QCRYCPKSFSRP 263
            ..::.|               ||        |.|.:...|...:..:      :||.|.:.|.:|
  Fly   174 AVILSRITLGASLEEEVYVIEDESAKQDLGQEKLSISSKLLGARKRRGVRHTLECRICHRGFYKP 238

  Fly   264 VNTLRHMRMHWDKKKYQCEKCGLRFSQDNLLYNH--RLRHEAEENPII--CSICNVSFKSRKTFN 324
            .....||:.|...:.|.|..|...:::.|||.:|  ::.:.|:...||  |..||..:.:.::..
  Fly   239 SLLEAHMQQHEGLRPYTCVHCAKSYARANLLESHLRQMHNNADAARIIYACPSCNKVYTANRSLK 303

  Fly   325 H-----HTLIHKENRP--RHYCSVCPKSFTERYTLKMHMKTHEGDVVYGVREEAP-----ADEQQ 377
            :     |...|:...|  ||.|..|.|.|..    |.|:..|:  :|:|..|...     .|.:.
  Fly   304 YHMRRTHERYHESESPDARHICEECGKCFAR----KAHLTRHK--MVHGSVEGRRYCCECCDRRF 362

  Fly   378 VVEELHVDVDESEAAVTVIMSDNDENSGF-CLICNTNFENKKELEHH 423
            ..:|..||        .::....::|... |..|...|:|..||..|
  Fly   363 YTKENMVD--------HLLRKHGNKNLLLRCRKCGRIFQNSVELNAH 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 44/215 (20%)
C2H2 Zn finger 225..245 CDD:275368 7/43 (16%)
C2H2 Zn finger 253..273 CDD:275368 7/19 (37%)
C2H2 Zn finger 281..301 CDD:275368 6/21 (29%)
C2H2 Zn finger 310..327 CDD:275370 3/21 (14%)
zf-C2H2 337..359 CDD:278523 7/21 (33%)
C2H2 Zn finger 339..359 CDD:275368 6/19 (32%)
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 18/103 (17%)
C2H2 Zn finger 228..248 CDD:275368 7/19 (37%)
C2H2 Zn finger 256..313 CDD:275368 13/56 (23%)
C2H2 Zn finger 289..314 CDD:275368 4/24 (17%)
zf-C2H2 323..345 CDD:278523 8/27 (30%)
C2H2 Zn finger 325..345 CDD:275368 7/25 (28%)
C2H2 Zn finger 355..376 CDD:275368 4/28 (14%)
C2H2 Zn finger 385..405 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455444
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.