DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and CG12942

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_610628.2 Gene:CG12942 / 36158 FlyBaseID:FBgn0033569 Length:686 Species:Drosophila melanogaster


Alignment Length:580 Identity:122/580 - (21%)
Similarity:184/580 - (31%) Gaps:201/580 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CFFCGAVDLSDTGSSSSMRYETLSAKVPSSQKTVSLVLTHLANCIQTQLDLK---PGA-----RL 60
            |..|.:||         .:...|:|:||:.|||.:...: |..|  |.|||:   ||.     ::
  Fly    22 CRACLSVD---------RKTVQLNAEVPNLQKTRTYAQS-LKQC--TNLDLRVISPGGYLWPMQI 74

  Fly    61 CPRCFQELSDYDTIMVNLMTTQKRLTTQLK--------------GALK--------------SEF 97
            |.||.:.|.      |.:...:..|.:.||              |.||              .||
  Fly    75 CVRCCRALE------VAMHFVEMALESNLKLQAEAKSVKLPSPTGELKRKASNETIPWNQFSQEF 133

  Fly    98 EVPESGEDILVEE-------VEIPQSDVETDADAEADALFVELVKDQEESDTEIKREFVDEEEEE 155
            |....|.:..:||       .::|:.||:..:.:|.      ..|:.|....::|.:..|.|||:
  Fly   134 EQFVEGYEGPIEENVLYMRGTKVPRLDVDASSSSET------APKEDEVILFDVKYDTNDLEEED 192

  Fly   156 DDDDDD----------------------------------EFICEDVDVGDSE------AL-YGK 179
            ::|..|                                  .|..::.||.|.|      || ...
  Fly   193 ENDGSDAKNNETFFENSITPGESVMVVSVAEKAVENNNNYNFNNKNGDVTDEECDLIQRALEMTL 257

  Fly   180 SSDGEDRPTKKRVKQE--------------------------------CTTCGKVYNSWYQLQKH 212
            :.||..:..|.....|                                |..|...:....||:.|
  Fly   258 NDDGCSQSPKNEASNETQLKSNGIEVSSPLFIKLATTSSTTGNIPILKCNICQYTHTDAEQLKIH 322

  Fly   213 ISEEH------------SKQPNHICPICGVIR-RDEEYLELHMNLH---EGKTEKQC---RYCPK 258
            ....|            :|..|..|..|.... :|...::.|:..|   :|..|..|   ..|| 
  Fly   323 YKSIHKISMMEDDIIGLNKNQNFKCRPCNSYETKDRSEMQKHLIDHHKIDGDFEMYCYMQANCP- 386

  Fly   259 SFSRPVNTLRHMRMHWDK------------KKYQCEKCGLRFSQDNLLYNHRLRHEAEENPIICS 311
            :..|.....|..|.|:.:            :.|.|..|...|:|...|::|: |....::.:.||
  Fly   387 ACDRIFKDQRSARKHYTRVHTPVQIAVSPTESYACTACDKVFNQKASLHSHQ-RFCQVKDVVHCS 450

  Fly   312 ICNVSFKSRKTFNHHTLIHKENRPRHYCSVCPKSFTERYTLKMHMKTHEGDVVYGVREEAPADEQ 376
            .|:..|.|.:.:..|..........|.|.:|.:||....||.||.|.|                 
  Fly   451 FCDQQFNSMRKYELHLQQLHAVETVHECEICRRSFKSAETLTMHRKRH----------------- 498

  Fly   377 QVVEELHVD--------VDESEAAVTVIMSDNDENSGFCLICNTNFENKKELEHHLQFDH 428
               .|.|..        |:.:|..|....:..:|....||.|...|:|...|..|.|..|
  Fly   499 ---SERHYQCGKCSLNYVNSAELRVHYERAHVNEEPVSCLTCGNQFQNMTLLREHEQRSH 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 44/185 (24%)
C2H2 Zn finger 225..245 CDD:275368 4/20 (20%)
C2H2 Zn finger 253..273 CDD:275368 6/22 (27%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..327 CDD:275370 5/16 (31%)
zf-C2H2 337..359 CDD:278523 10/21 (48%)
C2H2 Zn finger 339..359 CDD:275368 9/19 (47%)
CG12942NP_610628.2 zf-AD 22..101 CDD:285071 27/96 (28%)
C2H2 Zn finger 385..406 CDD:275368 6/21 (29%)
C2H2 Zn finger 421..470 CDD:275368 13/49 (27%)
C2H2 Zn finger 449..466 CDD:275371 5/16 (31%)
C2H2 Zn finger 478..498 CDD:275368 9/19 (47%)
C2H2 Zn finger 505..526 CDD:275368 3/20 (15%)
C2H2 Zn finger 534..555 CDD:275368 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440054
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.