DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and CG1602

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_610291.2 Gene:CG1602 / 35684 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster


Alignment Length:485 Identity:98/485 - (20%)
Similarity:158/485 - (32%) Gaps:173/485 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AVDLSDTGS-------------SSSMRYETLSAKVPS-SQKTVSLVLTHLANCIQTQLDLKPGAR 59
            |:||..|.|             ...|::.|:..:|.| .||..||..:..              :
  Fly   189 AIDLEATVSVFLNEMALKLAIKKVHMQFNTVHKRVVSGKQKPQSLAFSIY--------------K 239

  Fly    60 LCPRCFQELSDYDTIMVNL------MTTQKRLTT----------QLKGALKSEFEVPESGE---D 105
            ||  ||...|:.:....|.      .:.:.:|||          ||..:...||....|.:   :
  Fly   240 LC--CFLNASNDEEGATNNEKIKLDFSKKNKLTTDLIEMYANFPQLYDSNHKEFSNMSSRKQAYE 302

  Fly   106 ILVEEVEIPQSDVETD----------------------ADAEADALFVELVKDQEESDTEIKREF 148
            .:..|:.:|..|:.:|                      |.:.|:..::|                
  Fly   303 SMAAEISVPNVDINSDDIFRAIQNLRQWYYKNTKHAIYAGSTAEKFYLE---------------- 351

  Fly   149 VDEEEEEDDDDDDEFICEDVDVGDSEALYGKSSDGEDRPTKKRVKQE--CTTCGKVYNSWYQLQK 211
                           :|..:..                   |..||.  |..|.::.:|.:.||.
  Fly   352 ---------------VCRFMPA-------------------KMYKQRLVCEFCHQITSSDHVLQS 382

  Fly   212 HISEEHS--KQPNHICPIC--GVIRRDEEYLELHM-NLHEGKTEKQCRYCPKSFSRPVNTLRHMR 271
            ||.:.|:  :.| ..|.:|  ..:.|.|  |..|: .:|.|||.| |.:|.:||:...:...|:|
  Fly   383 HIFKAHNIGELP-FKCTLCDRSFVGRCE--LANHIQRVHIGKTHK-CTHCERSFAVMSDLQLHIR 443

  Fly   272 MHWDKKKYQCEKCGLRFSQDNLLYNHRLRHEAEENPIICSICNVSFKSRKTFNHHTLIHKENRPR 336
            .|...|.|.||.||..|...:.:..|......:.....|::|...|..:...:.|...|...|.:
  Fly   444 THTGHKPYVCEHCGKAFRLRSQMTLHVTAIHTKIRAFKCTMCPKDFVKKVDLSDHIKGHLNIRDK 508

  Fly   337 HYCSVCPKSFTERYTLKMHMKTHEGDVVYGVREEAPADEQQVVEELHVDVDESEAAVTVIMSDND 401
             .||||.|.||..:.|..|.:.|                             ||....|      
  Fly   509 -ICSVCGKGFTSCHALIRHRQIH-----------------------------SEVKKFV------ 537

  Fly   402 ENSGFCLICNTNFENKKELEHHLQFDHDVV 431
                 |.:|::.|.....|..|::..|:::
  Fly   538 -----CKLCDSRFSQFVGLNTHMKRTHNIL 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 48/159 (30%)
C2H2 Zn finger 225..245 CDD:275368 6/22 (27%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..327 CDD:275370 3/16 (19%)
zf-C2H2 337..359 CDD:278523 9/21 (43%)
C2H2 Zn finger 339..359 CDD:275368 9/19 (47%)
CG1602NP_610291.2 GT1 157..244 CDD:304916 16/70 (23%)
MADF_DNA_bdg 273..356 CDD:287510 13/113 (12%)
C2H2 Zn finger 367..388 CDD:275368 7/20 (35%)
C2H2 Zn finger 397..418 CDD:275368 6/22 (27%)
COG5048 <423..554 CDD:227381 39/172 (23%)
C2H2 Zn finger 425..445 CDD:275368 6/19 (32%)
zf-H2C2_2 437..460 CDD:290200 9/22 (41%)
C2H2 Zn finger 453..470 CDD:275368 5/16 (31%)
C2H2 Zn finger 482..502 CDD:275368 4/19 (21%)
C2H2 Zn finger 510..530 CDD:275368 9/19 (47%)
C2H2 Zn finger 538..559 CDD:275368 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439999
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.