DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and CG1529

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster


Alignment Length:436 Identity:104/436 - (23%)
Similarity:159/436 - (36%) Gaps:134/436 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 ARLCPRCFQELSDYDTIMVN---LMTTQKRLTTQLKGALKSEFEVP------------------- 100
            ||||..|.:.|.|.||...:   :...||.|...:   ||.....|                   
  Fly     9 ARLCRICLRHLRDRDTHCPDPRLIAILQKLLDIDI---LKQPHGFPTEICNLCHNAVVYFDELRQ 70

  Fly   101 ---ESGE--------DILVEEV-------------EIPQSDVETDADAEADALFVELVKDQEESD 141
               ||.:        ||.|:.|             |..:.::|.:.:.:||...|:|.|.||:  
  Fly    71 VARESSQKLIGWQPVDIAVDRVKEEPPDEGLKENHEENEHELEEEHEKQADGQQVDLSKKQED-- 133

  Fly   142 TEIKREFVDEEEEEDDDDDDEFICEDVDVGDSEALYGKSSDGEDRPTKKRVKQECTTCGK-VYNS 205
               :::.:|:.|:|:..|:.|...:.:..|..              :|:|....|..||| ||  
  Fly   134 ---QKKILDDREDEEYPDEYENSQQQLSQGTG--------------SKRRAGLACDQCGKQVY-- 179

  Fly   206 WYQLQKHISEEHSKQPNHICPICGVIRRDEEYLELHM-NLHEGKTEK-QCRYCPKSFSRPVNTLR 268
                         |.|               |||.|: ::|:|.::. .||.|.|||:|......
  Fly   180 -------------KLP---------------YLEAHIRSVHQGYSKPFLCRSCDKSFTRYEQLRS 216

  Fly   269 HMR-MHWDKKKYQ-------CEKCGLRFSQDNLLYNHRLRHEAEENPIICSICNVSFKSRKTFNH 325
            ||| .|...::.|       ||.|..::|..|.|..|..|| |:....:|..|.|:..:|.....
  Fly   217 HMRNAHPQLEQLQQELRDLICELCNRQYSTKNALGEHLKRH-AQRKEHVCEHCGVAKVTRTELLT 280

  Fly   326 HTLIHKENRPRHYCSVCPKSFTERYTLKMHMK-THEG---------DVVYGVREEAPADEQQVVE 380
            |...|.....|..|..||:.|..:..:..|:: .|||         :..:|...     .|...|
  Fly   281 HLRTHNPTWERFKCEQCPQLFRHKSAISRHVRVVHEGQRRFQCGHCEKKFGTHA-----SQVRHE 340

  Fly   381 ELHVD-VDESEAAVTVIMSDNDENSGFCLICNTNFENKKELEHHLQ 425
            .||.: ....|||        :|....|:.|.....:::.||.||:
  Fly   341 RLHTESTGSGEAA--------EEWPFACIHCQKPCVSRQTLELHLR 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 42/165 (25%)
C2H2 Zn finger 225..245 CDD:275368 4/20 (20%)
C2H2 Zn finger 253..273 CDD:275368 10/20 (50%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
C2H2 Zn finger 310..327 CDD:275370 4/16 (25%)
zf-C2H2 337..359 CDD:278523 5/22 (23%)
C2H2 Zn finger 339..359 CDD:275368 5/20 (25%)
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071 15/70 (21%)
C2H2 Zn finger 171..192 CDD:275368 12/50 (24%)
zf-C2H2_2 201..>257 CDD:289522 19/55 (35%)
C2H2 Zn finger 201..222 CDD:275368 10/20 (50%)
C2H2 Zn finger 237..257 CDD:275368 7/19 (37%)
C2H2 Zn finger 265..285 CDD:275368 5/19 (26%)
zf-C2H2_8 268..349 CDD:292531 19/85 (22%)
C2H2 Zn finger 294..315 CDD:275368 5/20 (25%)
C2H2 Zn finger 323..343 CDD:275368 3/24 (13%)
C2H2 Zn finger 360..380 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.