DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and CG7101

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster


Alignment Length:254 Identity:53/254 - (20%)
Similarity:83/254 - (32%) Gaps:69/254 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 LYGKSSDGEDRPTKKRVKQE--CTTCGKVYNSWYQLQKHISEEHSKQPNHICPIC---------- 228
            |:|:.:..|....:|....:  |..|||.|.|...|.:|::..|.:|....|.:|          
  Fly    70 LFGEEARLERHRERKHNDGQFLCLQCGKKYASATFLYRHVASWHGQQSLFYCDMCTDNCNDVKTF 134

  Fly   229 -GVIRRDEEYLELH---------------------MNLHEGKTEK-------------------- 251
             |::...|...|:|                     :.:.|...|.                    
  Fly   135 SGMLELQEHAEEVHRLRTLKSTASDADSQVDEMEDLEMLEENIENILPSIDWDDDLTFGWPTDLD 199

  Fly   252 -------------QCRYCPKSFSRPVNTLRHMRMHWDKKKYQCEKCGLRFSQDNLLYNHRLRHEA 303
                         .|.:|...|...::.:||:....::....|..||........|.:|..|...
  Fly   200 KESCIVNAKPSVFVCPFCANGFPGSLSLVRHLEQVHERSALDCCYCGKSHGSREALRSHLQRVHI 264

  Fly   304 EENPIICSICNVSFKSRKTFNHH-TLIHKENRPRHYCSVCPKSFTERYTLKMHMKTHEG 361
            .....:|.||...|.:......| ..:|.::|| |.|..|.|.||:|..|..|:||..|
  Fly   265 LLRGHVCGICQADFATADHLKKHVNSLHLDHRP-HLCPTCGKRFTQRCHLTDHIKTDRG 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 43/220 (20%)
C2H2 Zn finger 225..245 CDD:275368 6/51 (12%)
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
C2H2 Zn finger 281..301 CDD:275368 5/19 (26%)
C2H2 Zn finger 310..327 CDD:275370 5/17 (29%)
zf-C2H2 337..359 CDD:278523 10/21 (48%)
C2H2 Zn finger 339..359 CDD:275368 9/19 (47%)
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 11/52 (21%)
C2H2 Zn finger 242..263 CDD:275368 6/20 (30%)
C2H2 Zn finger 271..292 CDD:275368 5/20 (25%)
C2H2 Zn finger 300..319 CDD:275368 8/18 (44%)
C2H2 Zn finger 330..347 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455507
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.