DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and CG11695

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster


Alignment Length:565 Identity:112/565 - (19%)
Similarity:176/565 - (31%) Gaps:210/565 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CFFCGAVDLSDTGSSSSMRYETLSAKVPSSQKTVSLVLTHLANCIQTQLDLKP----GARLCPRC 64
            |..|    |.|...|..:..:..|...|.......|:..||      ||.|.|    ...||.:|
  Fly     3 CRLC----LDDAEHSVPIFDQDDSGDQPVPSNLAELIEKHL------QLVLLPNDGVSKSLCTQC 57

  Fly    65 FQELSDYDTIMVNLMTTQKRLTTQLKGALKSEFEVPESGEDILVEEVEIPQSDV----------- 118
            :|:|:|::.....:|..|..| .|||....||.|..::...||.|    |:.||           
  Fly    58 WQQLADFEQFCAMVMKKQLGL-QQLKMEPFSEDEDADTKAQILCE----PEIDVSPAAADNEECN 117

  Fly   119 ETDADAEAD-------------------------------ALFVELVKDQEESDTEIKREFVDEE 152
            |.|.||.::                               |...:.||.:..:.|. |.|..::|
  Fly   118 EIDGDASSNSRSSSIRTTSLREMRLPSPIRRRMRLPRAVTAPKTQAVKAKARTKTH-KAEADEDE 181

  Fly   153 EEEDDDDDDEFICEDVDVGDSEALYGKSSDGEDRPTKKRVKQECTTCG--KVYNSWYQLQKHISE 215
            :.|.:.|.:.......::....||:|              :.||..||  :.:.::.::::|...
  Fly   182 DAEGEGDPESRSSNSREMDSYIALHG--------------RLECCICGGDEQFPNFAEMKRHFRN 232

  Fly   216 EHS-------------------------KQPNHI-CPICGV-----IRRDEEYLELHMN------ 243
            .|.                         ..||:. |.||..     |..|...|..|.|      
  Fly   233 HHQSLGYVVCCQRRYKKRALYVDHLHMHNDPNYFRCKICSKQLVSRISYDVHMLRFHPNKDDLSF 297

  Fly   244 --------------------LHEGKTEKQCRYCPKSFSRPVNTLRHMRMHWDKK--KYQCEKCGL 286
                                :|:.:..:||::|.:||...|:...|||...|..  .:.|:.||.
  Fly   298 ACDQCSKRFSKQFLLTIHSRVHQQERNEQCKHCDRSFRTAVDLRLHMRRTHDPAFVPFICDSCGA 362

  Fly   287 RF-SQDNLLYNHRLRH-EAEENP-IICSICNVSFKSRKTFNHHTLIH------------------ 330
            :| ::.|||.:.|..| |..:.| :.|..|.|......:...|..:|                  
  Fly   363 KFKTKQNLLVHKRTVHREGSQLPEVQCQECQVWLSDENSLRKHMYMHLDAASLRQWKCEQCGLEK 427

  Fly   331 ----------KENRPRHY--CSVCPKSFTERYTLKMHMKTHEGDVVYGVREEAPADEQQVVEELH 383
                      :.:.|:.|  |:.|.|.|....:|:.|..||.|..:|.                 
  Fly   428 GSRAKLAAHIRYHHPKEYHKCTHCAKEFKSSRSLEEHTATHTGQDLYE----------------- 475

  Fly   384 VDVDESEAAVTVIMSDNDENSGFCLICNTNFENKKELEHHLQFDH 428
                                   |..|...|:|...:..|.:..|
  Fly   476 -----------------------CAFCERTFKNSGNMHKHRRQMH 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 48/246 (20%)
C2H2 Zn finger 225..245 CDD:275368 8/50 (16%)
C2H2 Zn finger 253..273 CDD:275368 8/19 (42%)
C2H2 Zn finger 281..301 CDD:275368 8/20 (40%)
C2H2 Zn finger 310..327 CDD:275370 3/16 (19%)
zf-C2H2 337..359 CDD:278523 7/23 (30%)
C2H2 Zn finger 339..359 CDD:275368 6/19 (32%)
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 23/88 (26%)
C2H2 Zn finger 268..289 CDD:275368 6/20 (30%)
C2H2 Zn finger 299..319 CDD:275368 0/19 (0%)
C2H2 Zn finger 327..348 CDD:275368 8/20 (40%)
C2H2 Zn finger 357..376 CDD:275368 7/18 (39%)
C2H2 Zn finger 389..409 CDD:275368 4/19 (21%)
C2H2 Zn finger 420..440 CDD:275368 0/19 (0%)
C2H2 Zn finger 448..468 CDD:275368 6/19 (32%)
C2H2 Zn finger 476..494 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455493
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.