DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and CG43347

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001138185.2 Gene:CG43347 / 31991 FlyBaseID:FBgn0263072 Length:2684 Species:Drosophila melanogaster


Alignment Length:430 Identity:96/430 - (22%)
Similarity:147/430 - (34%) Gaps:136/430 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ELSDYDTIMVNLMTTQKRLTTQLKGALKSEFEV-----------------------PESGEDILV 108
            :||:.:|         |.|.|..:.::.:|||:                       |..|:.:..
  Fly  1014 QLSELET---------KPLITFAEASVPAEFELHNVEPNVTGVFARTEVRAFTKLGPLIGQPVQT 1069

  Fly   109 EEVEIPQSDVE-----TDADAEADAL-------------FVELVKDQEESD---TEIKRE--FVD 150
            .||. ..||::     .:|.|:...|             ||......||.:   ..|.|:  ||.
  Fly  1070 GEVR-EGSDMKWIFEMCEAGADKSYLLCCDNPNASNWLRFVRPAPSYEERNVNLVSIDRQAYFVS 1133

  Fly   151 EEEEEDDDDDDEFICEDVDVGDSEALYGKSSDGEDRPTKKRV-KQECTTCGKVYNSWYQLQKHIS 214
                          |.|:..| .|.||. |.|......||.. |..|..|...:......:.|.|
  Fly  1134 --------------CRDLRNG-MELLYW-SDDCNTMWRKKHTEKTNCGGCNLKFEHPLYYRTHCS 1182

  Fly   215 EEHSKQPN-----HICPICG--VIRRDEEYLELHMNLHEGKTEKQCRYCPKSFSRPVNTLRHMRM 272
            ..|....:     :.|.:||  |:.:| ..::.....|:||...||::|.|.|.|    |.::.|
  Fly  1183 VFHDPSMSLTIRKYHCKVCGEPVLGKD-NIMKHAAEKHDGKGAYQCQFCSKFFLR----LNYLEM 1242

  Fly   273 HW--------DKKKYQCEKCGLRFSQDNLLYNHRLRHEAEENPII----CSICNVSFKSRKTFNH 325
            |.        ::.:..|:.||.:|.|...|..|..|..::...::    |.:|:....||.....
  Fly  1243 HRTYGCASNPNRSRPVCDFCGRKFCQPQKLKAHIKRMHSDMAEVLRDFQCKLCSKLLGSRAALQR 1307

  Fly   326 HTL-IHKENRPRHYCSVCPKSFTERYTLKMHMKTHEGDVVYGVREEAPADEQQVVEELHVDVDES 389
            |:. :|..|.....|..|.|.|..|..||:||.||.     |||....|:.:             
  Fly  1308 HSKEVHSRNSTVVSCPRCQKLFQNRSNLKIHMLTHS-----GVRPFKCAEPE------------- 1354

  Fly   390 EAAVTVIMSDNDENSGFCLICNTNFENKKELEHHLQFDHD 429
                                ||..|..|:.|:.|.:..|:
  Fly  1355 --------------------CNAAFTTKQCLQFHYKKVHN 1374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 45/174 (26%)
C2H2 Zn finger 225..245 CDD:275368 5/21 (24%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
C2H2 Zn finger 310..327 CDD:275370 4/16 (25%)
zf-C2H2 337..359 CDD:278523 9/21 (43%)
C2H2 Zn finger 339..359 CDD:275368 9/19 (47%)
CG43347NP_001138185.2 NR_DBD_like 1198..>1268 CDD:295381 21/74 (28%)
C2H2 Zn finger 1198..1219 CDD:275368 5/21 (24%)
C2H2 Zn finger 1227..1255 CDD:275368 8/31 (26%)
C2H2 Zn finger 1259..1280 CDD:275368 8/20 (40%)
C2H2 Zn finger 1292..1313 CDD:275368 5/20 (25%)
C2H2 Zn finger 1322..1342 CDD:275368 9/19 (47%)
zf-H2C2_2 1334..1361 CDD:290200 13/64 (20%)
C2H2 Zn finger 1350..1373 CDD:275368 7/55 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.