DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and CG11398

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster


Alignment Length:363 Identity:80/363 - (22%)
Similarity:124/363 - (34%) Gaps:108/363 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 DAEADALFVELVKDQEES--DTEIKREFVDEEEEEDDDDDDEFICEDVDVGDSEALY-GKSSDGE 184
            :||..||.....:|:|.|  ..|::.|.::|..:........|:|.     ...||: .:.....
  Fly     8 EAEILALLPHTYEDEELSLNTEELQFEELNERSQHQQGGSPSFVCR-----RCPALFLTREELAA 67

  Fly   185 DRPTKK--------RVKQECTTCGKVYNSWYQL----------------------------QKHI 213
            .|||.:        ..:..|..||:|:.....|                            :.|:
  Fly    68 HRPTHRYQGGQQTPASEHACDACGRVFQKHNALVDHMNAHNDVRNYPCPECPARFVQRSNRECHL 132

  Fly   214 SEEHSKQPNHICPICGVIRRDEEYLELHMN---LHEGKTEKQCRYCPKSFSRPVNTLRHMRMHWD 275
            ...|.|...|.||..|..:|.::..|...:   :|:.:....|..|...||.|||..:|:..|..
  Fly   133 KNVHRKVYLHSCPEPGCKKRFQQRRECDQHVKTVHQNERNLVCDTCSARFSHPVNYRKHLASHGS 197

  Fly   276 KKKYQCEKCGLRF----SQDNLLYNHRLRHEAEENPIICSICNVSFKSRKTFNHHTLI---HKE- 332
            .|.|.|..||..|    ::|..|:.|.:.     ...|||:|...:..|.....|.|.   |.: 
  Fly   198 AKSYGCPICGKLFGRPENRDVHLFVHSIC-----KAYICSVCGADYMRRNQLIRHGLASGHHNDP 257

  Fly   333 ---NRPRHYCSVCPKSFTERYTLKMHMKTHEGDVVYGVREEAPADEQQVVEELH----VDVDESE 390
               .:|:...::..|:.::|..:                     ||.| .|||.    ||..:|.
  Fly   258 IVRQKPQFSPALAAKNRSQRSAI---------------------DESQ-DEELQWLKGVDALDSA 300

  Fly   391 AAVTVIMSDNDENSGFCLICNT--------NFENKKEL 420
            ..:        |||.|   .||        ..||:.||
  Fly   301 GYL--------ENSQF---SNTGKMTAIFAEDENESEL 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 40/196 (20%)
C2H2 Zn finger 225..245 CDD:275368 5/22 (23%)
C2H2 Zn finger 253..273 CDD:275368 8/19 (42%)
C2H2 Zn finger 281..301 CDD:275368 7/23 (30%)
C2H2 Zn finger 310..327 CDD:275370 4/16 (25%)
zf-C2H2 337..359 CDD:278523 2/21 (10%)
C2H2 Zn finger 339..359 CDD:275368 2/19 (11%)
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 5/24 (21%)
C2H2 Zn finger 87..107 CDD:275368 5/19 (26%)
C2H2 Zn finger 115..136 CDD:275368 1/20 (5%)
C2H2 Zn finger 144..165 CDD:275368 5/20 (25%)
C2H2 Zn finger 175..195 CDD:275368 8/19 (42%)
C2H2 Zn finger 203..223 CDD:275368 6/19 (32%)
C2H2 Zn finger 231..247 CDD:275368 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.