DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and Opbp

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster


Alignment Length:522 Identity:113/522 - (21%)
Similarity:177/522 - (33%) Gaps:194/522 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DLKPGA--------RLCPRCFQELSDYDTIMVNLMTTQKRLTTQLKGALKSEFEVPESGEDILVE 109
            ||..||        ..|...:::...||    .....|....|...|.|  :| :.|..||.:.|
  Fly    20 DLSGGALQQEFLYCESCGNVYEDTESYD----RAHGPQAGCCTGASGEL--DF-IEEVAEDCISE 77

  Fly   110 EV---EIPQSDV-------ETDADAEADALFVELVKDQEESDTEIKREFVDEEEE--EDDDDDDE 162
            ||   :|..:||       |..|:.:|:       |||.|.... .|.|..:...  |:.:..:|
  Fly    78 EVGEEDIVYADVPLWELVEEVPANVKAE-------KDQNEPSNS-DRYFCYDCHSIFENRNKAEE 134

  Fly   163 FICEDVDVGDSEALYGKSSDGEDR-PTKKRVKQ--------------ECTTCGKVYNSWYQLQKH 212
            .||...:.|.|     ...||:.: |.::::..              .|..|..|::|...|:.|
  Fly   135 HICPRAESGGS-----SQQDGDAKAPVRRKLASVSARTGPRDASSVISCGICNTVFSSEKFLKFH 194

  Fly   213 ISEEHSKQPNHI-----------------------------------------------CPICGV 230
            :....::.|..|                                               |.||..
  Fly   195 MRIHENRAPKSIQDALPIGAHQQYSELDQFYCEICNKSFDETLLTVHKQMHQQESSEIMCSICNR 259

  Fly   231 IRRDEEYLELHMNLHEGKTEKQ-------------------CRYCPKSFSRPVNTLRHMRMHWDK 276
            ...:|...::|..:||...:.:                   |:||.:.|:||...::|.|:|..:
  Fly   260 KFENEVTYQMHQKIHEKPRDSESSRKLAQRTSLDKEKPGFPCQYCERVFTRPFEKVKHERVHTGE 324

  Fly   277 KKYQCEKCGLRFSQDNLLYNHRLRHEAEENPIICSICNVSFKSRKTFNHHTLIHKENR------- 334
            |.|.||.||..|.....|..| ||......|.:|::||..|||.:.::||..||...|       
  Fly   325 KPYACEVCGKTFRVSYSLTLH-LRTHTNIRPYVCTVCNKRFKSHQVYSHHLRIHSSERQFSCDAC 388

  Fly   335 PRHY------------------CSVCPKSFTERYTLKMHMKTH-----EGDVVYG---VREEAPA 373
            |:.:                  |:||.:.|:..|.:|.||:||     :|.|..|   ::..|.:
  Fly   389 PKTFRTSVQLYAHKNTHTKPYRCAVCNRPFSSMYAVKNHMQTHKEISSKGSVGSGTPNIKSAATS 453

  Fly   374 DEQQ----------------------------VVEE----------LHV-DVDESEAAVTVIMSD 399
            ..|.                            :|||          .|| :.|:||.||.:..::
  Fly   454 KSQAAGKFYCNTCGAEYARLFALRLHMKSAHGLVEEQENPATSTDAAHVAETDDSETAVLIAAAE 518

  Fly   400 ND 401
            .|
  Fly   519 AD 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 55/250 (22%)
C2H2 Zn finger 225..245 CDD:275368 5/19 (26%)
C2H2 Zn finger 253..273 CDD:275368 8/19 (42%)
C2H2 Zn finger 281..301 CDD:275368 8/19 (42%)
C2H2 Zn finger 310..327 CDD:275370 7/16 (44%)
zf-C2H2 337..359 CDD:278523 8/39 (21%)
C2H2 Zn finger 339..359 CDD:275368 8/19 (42%)
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 5/19 (26%)
C2H2 Zn finger 301..321 CDD:275368 8/19 (42%)
zf-H2C2_2 316..336 CDD:290200 9/19 (47%)
C2H2 Zn finger 329..349 CDD:275368 9/20 (45%)
zf-H2C2_2 341..366 CDD:290200 9/25 (36%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
C2H2 Zn finger 385..405 CDD:275368 1/19 (5%)
C2H2 Zn finger 411..431 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.