DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and let-391

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_491744.3 Gene:let-391 / 182953 WormBaseID:WBGene00006492 Length:453 Species:Caenorhabditis elegans


Alignment Length:184 Identity:45/184 - (24%)
Similarity:75/184 - (40%) Gaps:18/184 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 TEKQCRYCPKSFSRPVNTLRHMRMHWDKKKYQCEKCGLRFSQDNLLYNHRLRHEAEENPIICS-I 312
            |..||..|......|.....|:|.|..:|.::|.:|||..|:.:.|..|..|....|.|..|: .
 Worm   266 TLAQCNICGLMLKHPSKIADHIRTHTGEKPFECGECGLSLSKASSLKVHIRRMHTGERPFECTWR 330

  Fly   313 CNVSFKSRKTFNHHTLIHKENRPRHYCSV--CPKSFTERYTLKMHMKTHEGDVVYGVREEAPADE 375
            |.:||.:......|.:.......|:.|.|  |...|..|..|..|.|....::.           
 Worm   331 CGLSFVTDSVRKEHEMTVHTGIKRYTCVVKGCNAVFARRVYLMRHRKNAHPELF----------- 384

  Fly   376 QQVVEELHVDVDESEAAVTVIMSDNDENSGFCLICNTNFENKKELEHHLQFDHD 429
            ..:.:.:.|:.:||:.:|.|...|:::|:...::.... ::.|.|.|   |:.|
 Worm   385 TPIFDHVQVNHEESQDSVIVYEDDHEQNNQIIMLTGDG-DDVKILAH---FEDD 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 33/113 (29%)
C2H2 Zn finger 225..245 CDD:275368
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
C2H2 Zn finger 310..327 CDD:275370 4/17 (24%)
zf-C2H2 337..359 CDD:278523 8/23 (35%)
C2H2 Zn finger 339..359 CDD:275368 8/21 (38%)
let-391NP_491744.3 C2H2 Zn finger 59..79 CDD:275368
zf-H2C2_2 73..96 CDD:290200
C2H2 Zn finger 87..108 CDD:275368
C2H2 Zn finger 116..137 CDD:275368
C2H2 Zn finger 270..290 CDD:275368 5/19 (26%)
zf-H2C2_2 286..304 CDD:290200 7/17 (41%)
C2H2 Zn finger 298..319 CDD:275368 8/20 (40%)
C2H2 Zn finger 327..347 CDD:275368 5/19 (26%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.