DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and unc-98

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_509284.2 Gene:unc-98 / 181020 WormBaseID:WBGene00006827 Length:310 Species:Caenorhabditis elegans


Alignment Length:299 Identity:65/299 - (21%)
Similarity:104/299 - (34%) Gaps:72/299 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 DVETDADAEADALFVELVKDQEESDTEIK-REFV---------DEEEEEDDDDDDEFICE----- 166
            |:..:|..|.|. |.||:...:.:...:| .|.|         .|..|..:.:..:.|.:     
 Worm     4 DIFKEARKERDD-FEELMNACDLAKMSVKNNEMVHGLETFGINGESSENGNKEKPKEIMKVVAPT 67

  Fly   167 -DVDVGDSEA-----LYGKSSDGEDRPTKKRVKQECTTCGKVYNS--WYQLQKHISEEHSKQPNH 223
             :..||.|.|     ..|.:.||.|   ::.|:|:.|:..|..|.  :|:               
 Worm    68 VEAYVGSSSAQTPTKSSGGALDGSD---QQEVRQDGTSVQKDDNGFVFYK--------------- 114

  Fly   224 ICPICGVIRRDEEYLELHMNLHEGKTEKQCRYCPKSFSRPVNTLRHMRMHWDKKKYQCEKCGLRF 288
             |..||:.......|..|..:|:......|..|..||........|...|.:...|:|| ||..|
 Worm   115 -CRFCGLTFNFMNTLRAHERIHDVSQPYVCGKCGDSFEFACQLEYHAAQHSEIDGYKCE-CGRTF 177

  Fly   289 SQDNLLYNHRLRHEAEENPI------ICSICNVSFK-----SRKTFNHHTLIHKENRPRH----- 337
                ..|...|.|:..::|:      ..:...||.|     |.:.......:.:...|:|     
 Worm   178 ----FSYTEMLYHKHTDDPLELIGAPETTTIKVSKKRVLPVSEQDLPQPAFVTEGYEPKHPLRVY 238

  Fly   338 --------YCSVCPKSFTERYTLKMHMKTHEGDVVYGVR 368
                    .|..|.||:::...|..||.:|.|:..:..|
 Worm   239 NDVRSKPYICEYCSKSYSDSRGLAYHMYSHRGEKYFNPR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 36/180 (20%)
C2H2 Zn finger 225..245 CDD:275368 5/19 (26%)
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
C2H2 Zn finger 310..327 CDD:275370 4/21 (19%)
zf-C2H2 337..359 CDD:278523 8/34 (24%)
C2H2 Zn finger 339..359 CDD:275368 7/19 (37%)
unc-98NP_509284.2 C2H2 Zn finger 115..135 CDD:275368 5/19 (26%)
C2H2 Zn finger 143..163 CDD:275368 5/19 (26%)
SFP1 <169..268 CDD:227516 23/103 (22%)
C2H2 Zn finger 171..189 CDD:275368 8/22 (36%)
C2H2 Zn finger 248..268 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.