DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and LOC100538196

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:XP_017210984.1 Gene:LOC100538196 / 100538196 -ID:- Length:420 Species:Danio rerio


Alignment Length:427 Identity:95/427 - (22%)
Similarity:153/427 - (35%) Gaps:120/427 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 VPESGEDILVEEV-EIPQSDVETDADAEADALFVELVKDQEESDTEIKREFVDEEEEEDDDD--- 159
            :.|..||:.:||. .:.|.|::...|     |.|...:..::::.:.|::|...:|...|:.   
Zfish     4 IKEESEDVKIEETFTVKQEDLQEQTD-----LMVRKEQTNQQNEIDEKQQFEKPQEITTDEKPIL 63

  Fly   160 -------------------------------------------DDEFICED-------------- 167
                                                       :..:.||.              
Zfish    64 TKKTSLNGRPRKSESGCNFSCKQCRKSFSQKSKLDVHMRVHTREQPYTCEQCGKSFGQIQGFKAH 128

  Fly   168 VDVGDSEALY-----GKS-------------SDGED----RPTKKRVKQE--------------- 195
            :.:...|..|     |||             ..||.    :...|...|:               
Zfish   129 MRIHTRERSYTCQQCGKSFYHAGHFAAHMRIHTGEKPFSCKQCGKSFSQKSNLDVHMRVHTGEKP 193

  Fly   196 --CTTCGKVYNSWYQLQKHISEEHSKQPNHICPICGVIRRDEEYLELHMNLHEGKTEKQCRYCPK 258
              |..|||.::.....:.|: ..|:.:.:..|..||...|....|.:||..|.|:....|:.|.|
Zfish   194 YTCEQCGKSFSQKQNFKTHM-RIHTGERSCTCQQCGKSFRHARNLAVHMRTHTGEKPFSCKQCRK 257

  Fly   259 SFSRPVNTLRHMRMHWDKKKYQCEKCGLRFSQDNLLYNHRLRHEAEENPIICSICNVSFKSRKTF 323
            |||:.:|.:.|||:|..:|.|.||:||..|.|...||.| :|....|.|..|:.|..||..:.|.
Zfish   258 SFSKKLNLIAHMRVHTREKPYTCEQCGKSFGQKQDLYIH-MRIHTGEKPYTCTECGKSFPHKSTL 321

  Fly   324 NHHTLIHKENRPRHYCSVCPKSFTERYTLKMHMKTHEGDVVYGVREEAPADEQQVVEELHVDVDE 388
            |:|...|...:| ..|..|.||||.:.:||.||..|.|.:|:            ..::....:..
Zfish   322 NNHVRTHTGEKP-FACDQCGKSFTTKTSLKNHMNGHTGTIVF------------TCDQCGKSLTR 373

  Fly   389 SEAAVTVIMSDNDENSGFCLICNTNFENKKELEHHLQ 425
            .::....:...:.|:...|..|...|:.|:.|..||:
Zfish   374 KDSIKNHMKIHSREDRFRCSECEKGFKCKRSLSSHLK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 55/154 (36%)
C2H2 Zn finger 225..245 CDD:275368 7/19 (37%)
C2H2 Zn finger 253..273 CDD:275368 10/19 (53%)
C2H2 Zn finger 281..301 CDD:275368 9/19 (47%)
C2H2 Zn finger 310..327 CDD:275370 6/16 (38%)
zf-C2H2 337..359 CDD:278523 10/21 (48%)
C2H2 Zn finger 339..359 CDD:275368 10/19 (53%)
LOC100538196XP_017210984.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.