DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-delta and znf1053

DIOPT Version :9

Sequence 1:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster
Sequence 2:XP_017211055.1 Gene:znf1053 / 100150608 ZFINID:ZDB-GENE-121214-1 Length:448 Species:Danio rerio


Alignment Length:387 Identity:92/387 - (23%)
Similarity:146/387 - (37%) Gaps:96/387 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 VPESGEDILVEEV-EIPQSDVETDADAEADALFVELVKDQEESDTEIKREFVDEEEEEDDDDDDE 162
            :.|..||:.:||. .:.|.|:                  ||::|    |..:.||..|.::.|::
Zfish     4 IKEESEDVKIEETFTVKQEDL------------------QEQTD----RMVLKEETHEQNEIDEK 46

  Fly   163 FICE---DVDVGDSEALYGK-SSDGEDRPTKKRVKQECTTCGKVYNSWYQLQKHISEEHSKQPNH 223
            .:.|   ::...:...|..| ||.|..|.:|......|..|.|.:|....|..|: ..|:.:..:
Zfish    47 LLFEKPQEITTDEKPTLTKKTSSHGRPRKSKSGCNFSCKQCRKSFNQKSNLHVHL-RVHTWEKPY 110

  Fly   224 ICPICGVIRRDEEYLELHMNLHEGKTEKQCRYCPKSFSRPVNTLRHMRMHWDKKKYQCEKCGLRF 288
            .|..||......:..::||.:|.|:::..|:.|.|||....|...|||:|..:|.:.|::||..|
Zfish   111 TCKQCGKSFSQIQGFKVHMRIHTGESKFTCQECGKSFYHAGNFAAHMRIHTGEKPFSCKQCGKSF 175

  Fly   289 SQDNLLYNHRLRHEAE---------------------------ENPIICSICNVSFKSRKTFNHH 326
            ||...|..|...|..|                           |.|..|..|..||..:::|..|
Zfish   176 SQKPNLDIHMRIHTGEKPFSCKQCGKSFSQKSHLDIHMRVHTGEKPYTCEQCGQSFSQKQSFKSH 240

  Fly   327 TLIHKENRPRHYCSVCPKSFTERYTLKMHMKTHEGDVVYGVRE--------------------EA 371
            ..||...|| :.|..|.|:|.....|..||:.|.|:..:..::                    |.
Zfish   241 MRIHTGERP-YTCQQCGKNFRHARNLAAHMRIHTGEKPFSCKQCGKSFSKKANLIAHMRVHTREK 304

  Fly   372 PADEQQVVEEL--------HVDVDESEAAVTVIMSDNDENSGFCLICNTNFENKKELEHHLQ 425
            |...:|..:.|        |:.:...|...|            |..|..:|.:...|:||::
Zfish   305 PYTCEQCGKSLGKKQDLYIHMRIHTGEKPYT------------CTECGKSFPHITTLKHHVR 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 50/181 (28%)
C2H2 Zn finger 225..245 CDD:275368 5/19 (26%)
C2H2 Zn finger 253..273 CDD:275368 9/19 (47%)
C2H2 Zn finger 281..301 CDD:275368 8/19 (42%)
C2H2 Zn finger 310..327 CDD:275370 5/16 (31%)
zf-C2H2 337..359 CDD:278523 7/21 (33%)
C2H2 Zn finger 339..359 CDD:275368 7/19 (37%)
znf1053XP_017211055.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.