DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and Zkscan8

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_631880.2 Gene:Zkscan8 / 93681 MGIID:1913815 Length:588 Species:Mus musculus


Alignment Length:214 Identity:66/214 - (30%)
Similarity:96/214 - (44%) Gaps:33/214 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 SEEEFFTETTEIPCHICGEMFSSQEVLERHIKADTCQKSEQATCNVCGLKVKDDEVLDLHMNLHE 224
            |.::...:.....|..||:.||....|..|.:..|.:|..|  ||.||........|.||..:|.
Mouse   377 SHQDIHNKVKRYHCKECGKAFSQNTGLILHQRIHTGEKPYQ--CNQCGKAFSQSAGLILHQRIHS 439

  Fly   225 GKTELECRYCDKKFSHKRNVLRHMEVHWDKKKYQCDKCGERFSLSWLMYNHLMRHDAEENALICE 289
            |:...||..|.|.|||..:::.|..:|..:|.|:||:||:.|..|..:..|...|..|: ...|.
Mouse   440 GERPYECNECGKAFSHSSHLIGHQRIHTGEKPYECDECGKTFRRSSHLIGHQRSHTGEK-PYKCN 503

  Fly   290 VC------------HQQFKT-KRTYK---------------HHLRTHQTDRPRYPCPDCEKSFVD 326
            .|            ||:..| :|.||               .|||.|..::| |.|.:|.|:|:.
Mouse   504 ECGRAFSQKSGLIEHQRIHTGERPYKCKECGKAFNGNTGLIQHLRIHTGEKP-YQCSECRKAFIQ 567

  Fly   327 KYTLKVHKRVHQPVEKPES 345
            :.:|..|:|:|. .|||:|
Mouse   568 RSSLIRHQRIHS-AEKPQS 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 7/19 (37%)
C2H2 Zn finger 231..251 CDD:275368 7/19 (37%)
C2H2 Zn finger 259..308 CDD:275368 20/76 (26%)
C2H2 Zn finger 288..303 CDD:275370 8/42 (19%)
zf-C2H2 315..337 CDD:278523 8/21 (38%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
Zkscan8NP_631880.2 SCAN 48..158 CDD:128708
KRAB_A-box 233..268 CDD:143639
COG5048 <322..574 CDD:227381 59/200 (30%)
C2H2 Zn finger 334..354 CDD:275368
C2H2 Zn finger 363..382 CDD:275368 1/4 (25%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
C2H2 Zn finger 446..466 CDD:275368 7/19 (37%)
C2H2 Zn finger 474..494 CDD:275368 7/19 (37%)
C2H2 Zn finger 502..522 CDD:275368 4/19 (21%)
C2H2 Zn finger 530..550 CDD:275368 3/19 (16%)
C2H2 Zn finger 558..578 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.