Sequence 1: | NP_001303451.1 | Gene: | Sry-beta / 43570 | FlyBaseID: | FBgn0003511 | Length: | 356 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_631880.2 | Gene: | Zkscan8 / 93681 | MGIID: | 1913815 | Length: | 588 | Species: | Mus musculus |
Alignment Length: | 214 | Identity: | 66/214 - (30%) |
---|---|---|---|
Similarity: | 96/214 - (44%) | Gaps: | 33/214 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 160 SEEEFFTETTEIPCHICGEMFSSQEVLERHIKADTCQKSEQATCNVCGLKVKDDEVLDLHMNLHE 224
Fly 225 GKTELECRYCDKKFSHKRNVLRHMEVHWDKKKYQCDKCGERFSLSWLMYNHLMRHDAEENALICE 289
Fly 290 VC------------HQQFKT-KRTYK---------------HHLRTHQTDRPRYPCPDCEKSFVD 326
Fly 327 KYTLKVHKRVHQPVEKPES 345 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sry-beta | NP_001303451.1 | C2H2 Zn finger | 203..223 | CDD:275368 | 7/19 (37%) |
C2H2 Zn finger | 231..251 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 259..308 | CDD:275368 | 20/76 (26%) | ||
C2H2 Zn finger | 288..303 | CDD:275370 | 8/42 (19%) | ||
zf-C2H2 | 315..337 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 317..337 | CDD:275368 | 7/19 (37%) | ||
Zkscan8 | NP_631880.2 | SCAN | 48..158 | CDD:128708 | |
KRAB_A-box | 233..268 | CDD:143639 | |||
COG5048 | <322..574 | CDD:227381 | 59/200 (30%) | ||
C2H2 Zn finger | 334..354 | CDD:275368 | |||
C2H2 Zn finger | 363..382 | CDD:275368 | 1/4 (25%) | ||
C2H2 Zn finger | 390..410 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 418..438 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 446..466 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 474..494 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 502..522 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 530..550 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 558..578 | CDD:275368 | 7/19 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |