DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and zgc:174310

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001103997.1 Gene:zgc:174310 / 797700 ZFINID:ZDB-GENE-081022-6 Length:283 Species:Danio rerio


Alignment Length:233 Identity:75/233 - (32%)
Similarity:109/233 - (46%) Gaps:17/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 QATALKEPERQPGEEDECE-----EFMKEEMLDEEFQFSEPDDSMPSSE----EEFFTETTEIP- 172
            |.|.||.|:.:..||||.:     |..:....|....||..:..|..|:    ::...:.||.| 
Zfish    40 QQTDLKPPKVEDEEEDEFDFMTIVESKRAANADTTSHFSCQECGMGFSQKRDLKDHVRDHTERPY 104

  Fly   173 -CHICGEMFSSQEVLERH-IKADTCQKSEQATCNVCGLKVKDDEVLDLHMNLHEGKTELECRYCD 235
             |..||..|:.:..|:.| |...:.|.|   .|..||...:.::.|..||..|.|:....|.:|.
Zfish   105 TCPRCGLSFTLKRDLQNHRITQHSIQPS---ICGQCGKHFRTEDKLLSHMKTHTGEQPFVCGHCG 166

  Fly   236 KKFSHKRNVLRHMEVHWDKKKYQCDKCGERFSLSWLMYNHLMRHDAEENALICEVCHQQFKTKRT 300
            |.|:.||:...||.:|.::|...||:||:|||....:|:|...|..:....:||:|..:||.|..
Zfish   167 KGFTIKRSYQYHMTLHIEEKLLTCDQCGKRFSHEISLYHHRRVHQPKNGCFVCELCGMKFKRKDH 231

  Fly   301 YKHHLRTHQTDRPRYPCPDCEKSFVDKYTLKVH-KRVH 337
            .|.|.|.|....| |.|..|.:::..|..|..| ||.|
Zfish   232 LKAHERVHVAGSP-YVCVHCGRTYRTKGNLTQHEKRTH 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 6/19 (32%)
C2H2 Zn finger 231..251 CDD:275368 8/19 (42%)
C2H2 Zn finger 259..308 CDD:275368 19/48 (40%)
C2H2 Zn finger 288..303 CDD:275370 6/14 (43%)
zf-C2H2 315..337 CDD:278523 8/22 (36%)
C2H2 Zn finger 317..337 CDD:275368 7/20 (35%)
zgc:174310NP_001103997.1 COG5048 <74..235 CDD:227381 51/163 (31%)
C2H2 Zn finger 79..99 CDD:275368 2/19 (11%)
C2H2 Zn finger 106..126 CDD:275368 7/19 (37%)
C2H2 Zn finger 134..154 CDD:275368 6/19 (32%)
zf-H2C2_2 147..170 CDD:290200 8/22 (36%)
C2H2 Zn finger 162..182 CDD:275368 8/19 (42%)
C2H2 Zn finger 190..210 CDD:275368 9/19 (47%)
C2H2 Zn finger 219..239 CDD:275368 9/19 (47%)
C2H2 Zn finger 247..268 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.