DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and ZNF121

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001008727.1 Gene:ZNF121 / 7675 HGNCID:12904 Length:390 Species:Homo sapiens


Alignment Length:316 Identity:80/316 - (25%)
Similarity:129/316 - (40%) Gaps:43/316 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 NSAACRDCLEYLFNYDRLVRNLSQVQRQIADALLGCRQVEGKAETKQQAAKRARVQVPAFKIVQA 119
            |:....||.||..|:..|  :.|....:....|..||:.........|   |..:...:|     
Human    34 NTGDTYDCDEYGENFPML--HNSAPAGETLSVLNQCRKAFSLPPNVHQ---RTWIGDKSF----- 88

  Fly   120 TALKEPERQPGEEDECEE-FMKE------------EMLDEEFQFSEPDDSMPSSEEEFFTETTEI 171
                       |..:||| |:.:            |.|.|:.|.........|........|.|.
Human    89 -----------EYSDCEEAFVDQSHLQANRITHNGETLYEQKQCGRAFTYSTSHAVSVKMHTVEK 142

  Fly   172 P--CHICGEMFSSQEVLERHIKADTCQKSEQATCNVCGLKVKDDEVLDLHMNLHEGKTELECRYC 234
            |  |..||:.|.....|..|::..|.:|..:  |..||........|..|:.:|.|:...:|:.|
Human   143 PYECKECGKFFRYSSYLNSHMRTHTGEKPYE--CKECGKCFTVSSHLVEHVRIHTGEKPYQCKEC 205

  Fly   235 DKKFSHKRNVLRHMEVHWDKKKYQCDKCGERFSLSWLMYNHLMRHDAEENALICEVCHQQFKTKR 299
            .:.|:.:..:.:|:.:|..:|.|:|::||:.::..:|:..|...| .||....|:||.:.|::..
Human   206 GRAFAGRSGLTKHVRIHTGEKPYECNECGKAYNRFYLLTEHFKTH-TEEKPFECKVCGKSFRSSS 269

  Fly   300 TYKHHLRTHQTDRPRYPCPDCEKSFVDKYTLKVHKRVHQPVEKPESAEAKEATVTF 355
            ..|:|.|.|...:| |.|.:|.|:|....:|..|.::|.. |||  .|.|:....|
Human   270 CLKNHFRIHTGIKP-YKCKECGKAFTVSSSLHNHVKIHTG-EKP--YECKDCGKAF 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 5/19 (26%)
C2H2 Zn finger 231..251 CDD:275368 4/19 (21%)
C2H2 Zn finger 259..308 CDD:275368 15/48 (31%)
C2H2 Zn finger 288..303 CDD:275370 4/14 (29%)
zf-C2H2 315..337 CDD:278523 7/21 (33%)
C2H2 Zn finger 317..337 CDD:275368 6/19 (32%)
ZNF121NP_001008727.1 C2H2 Zn finger 65..82 CDD:275368 4/19 (21%)
COG5048 <85..270 CDD:227381 48/203 (24%)
C2H2 Zn finger 91..110 CDD:275368 4/18 (22%)
C2H2 Zn finger 119..138 CDD:275368 2/18 (11%)
zf-C2H2 144..166 CDD:278523 6/21 (29%)
C2H2 Zn finger 146..166 CDD:275368 6/19 (32%)
zf-H2C2_2 158..182 CDD:290200 7/25 (28%)
C2H2 Zn finger 174..194 CDD:275368 5/19 (26%)
zf-H2C2_2 186..210 CDD:290200 6/23 (26%)
C2H2 Zn finger 202..222 CDD:275368 4/19 (21%)
zf-H2C2_2 215..239 CDD:290200 7/23 (30%)
COG5048 <226..388 CDD:227381 33/101 (33%)
C2H2 Zn finger 230..250 CDD:275368 5/19 (26%)
zf-H2C2_2 243..267 CDD:290200 8/24 (33%)
C2H2 Zn finger 258..278 CDD:275368 7/19 (37%)
zf-H2C2_2 271..294 CDD:290200 9/23 (39%)
C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
zf-H2C2_2 301..323 CDD:290200 8/24 (33%)
C2H2 Zn finger 314..334 CDD:275368 2/8 (25%)
zf-H2C2_2 327..349 CDD:290200
C2H2 Zn finger 342..362 CDD:275368
zf-H2C2_2 354..379 CDD:290200
C2H2 Zn finger 370..390 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.