DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and ZNF506

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001092739.1 Gene:ZNF506 / 440515 HGNCID:23780 Length:444 Species:Homo sapiens


Alignment Length:348 Identity:86/348 - (24%)
Similarity:125/348 - (35%) Gaps:83/348 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IKD-----ILKYFEKIINQRLELLPNSAACRDCLEYLFNYDRLVRNLSQVQRQIADALLGCRQVE 94
            |||     ||:.:||..:..|:|.....:..:|..:...|:.|.:.|:..||:|.          
Human    91 IKDSFQKVILRRYEKCRHDNLQLKKGCESVDECPVHKRGYNGLKQCLATTQRKIF---------- 145

  Fly    95 GKAETKQQAAKRARVQVPAFKIVQATALKEPERQPGEEDECEEFMKEEMLDEEFQFSEPDDSMPS 159
                                                   :|:|::|   ...:|..|.......:
Human   146 ---------------------------------------QCDEYVK---FLHKFSNSNKHKIRDT 168

  Fly   160 SEEEF------------FTETT---------EIPCHICGEMFSSQEVLERHIKADTCQKSEQATC 203
            .::.|            .|.||         ...|..||:.:.....|..|.|..|.:|..:  |
Human   169 GKKSFKCIEYGKTFNQSSTRTTYKKIDAGEKRYKCEECGKAYKQSSHLTTHKKIHTGEKPYK--C 231

  Fly   204 NVCGLKVKDDEVLDLHMNLHEGKTELECRYCDKKFSHKRNVLRHMEVHWDKKKYQCDKCGERFSL 268
            ..||...|....|..|..:|.|:....||.|.|.|:|...:..|.::|..:|.|:|||||:.|..
Human   232 EECGKAYKQSCNLTTHKIIHTGEKPYRCRECGKAFNHPATLFSHKKIHTGEKPYKCDKCGKAFIS 296

  Fly   269 SWLMYNHLMRHDAEENALICEVCHQQFKTKRTYKHHLRTHQTDRPRYPCPDCEKSFVDKYTLKVH 333
            |..:..|.:.|..|: ...||.|.:.|........|.|.|..|.| |.|.:|.|:|....:|..|
Human   297 SSTLTKHEIIHTGEK-PYKCEECGKAFNRSSNLTKHKRIHTGDVP-YKCDECGKTFTWYSSLSKH 359

  Fly   334 KRVHQPVEKPESAEAKEATVTFF 356
            ||.|.. |||...|......|.|
Human   360 KRAHTG-EKPYKCEECGKAFTAF 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 6/19 (32%)
C2H2 Zn finger 231..251 CDD:275368 7/19 (37%)
C2H2 Zn finger 259..308 CDD:275368 16/48 (33%)
C2H2 Zn finger 288..303 CDD:275370 4/14 (29%)
zf-C2H2 315..337 CDD:278523 9/21 (43%)
C2H2 Zn finger 317..337 CDD:275368 8/19 (42%)
ZNF506NP_001092739.1 KRAB 4..62 CDD:214630
KRAB 6..43 CDD:279668
C2H2 Zn finger 147..167 CDD:275368 5/22 (23%)
C2H2 Zn finger 175..195 CDD:275368 3/19 (16%)
C2H2 Zn finger 203..223 CDD:275368 6/19 (32%)
zf-H2C2_2 215..240 CDD:290200 8/26 (31%)
C2H2 Zn finger 231..251 CDD:275368 6/19 (32%)
zf-H2C2_2 243..268 CDD:290200 9/24 (38%)
COG5048 <255..417 CDD:227381 45/130 (35%)
C2H2 Zn finger 259..279 CDD:275368 7/19 (37%)
zf-H2C2_2 272..296 CDD:290200 10/23 (43%)
C2H2 Zn finger 287..307 CDD:275368 8/19 (42%)
zf-H2C2_2 300..324 CDD:290200 7/24 (29%)
C2H2 Zn finger 315..335 CDD:275368 6/19 (32%)
zf-H2C2_2 327..351 CDD:290200 9/24 (38%)
C2H2 Zn finger 343..363 CDD:275368 8/19 (42%)
zf-H2C2_2 355..379 CDD:290200 9/24 (38%)
C2H2 Zn finger 371..391 CDD:275368 3/11 (27%)
zf-H2C2_2 384..407 CDD:290200
C2H2 Zn finger 399..419 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.