DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and Sry-delta

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster


Alignment Length:401 Identity:133/401 - (33%)
Similarity:203/401 - (50%) Gaps:64/401 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CFVCGK-------EKSVGVFQLIEGCIVPGTFKPIKDILKYFEKIINQRLELLPNSAACRDCLEY 65
            ||.||.       ..|...::.: ...||.:.|.:..:|.:....|..:|:|.|.:..|..|.:.
  Fly     4 CFFCGAVDLSDTGSSSSMRYETL-SAKVPSSQKTVSLVLTHLANCIQTQLDLKPGARLCPRCFQE 67

  Fly    66 LFNYDRLVRNLSQVQRQIADALLGCRQVEGKAETKQQAAKRARVQVPAFKI-----VQATALKEP 125
            |.:||.::.||...|:::...|.|..:.|.:.....:......|::|...:     .:|.||...
  Fly    68 LSDYDTIMVNLMTTQKRLTTQLKGALKSEFEVPESGEDILVEEVEIPQSDVETDADAEADALFVE 132

  Fly   126 ERQPGEEDECEEFMKEEMLDEEFQFSEPDDSMPSSEEEFFTETTEI------------------- 171
            ..:..||.:.|  :|.|.:|||.:..:.||      :||..|..::                   
  Fly   133 LVKDQEESDTE--IKREFVDEEEEEDDDDD------DEFICEDVDVGDSEALYGKSSDGEDRPTK 189

  Fly   172 -----PCHICGEMFSSQEVLERHIKADTCQKSEQATCNVCGLKVKDDEVLDLHMNLHEGKTELEC 231
                 .|..||::::|...|::|| ::...|.....|.:||:..:|:|.|:|||||||||||.:|
  Fly   190 KRVKQECTTCGKVYNSWYQLQKHI-SEEHSKQPNHICPICGVIRRDEEYLELHMNLHEGKTEKQC 253

  Fly   232 RYCDKKFSHKRNVLRHMEVHWDKKKYQCDKCGERFSLSWLMYNHLMRHDAEENALICEVCHQQFK 296
            |||.|.||...|.||||.:|||||||||:|||.|||...|:|||.:||:||||.:||.:|:..||
  Fly   254 RYCPKSFSRPVNTLRHMRMHWDKKKYQCEKCGLRFSQDNLLYNHRLRHEAEENPIICSICNVSFK 318

  Fly   297 TKRTYKHHLRTHQTDRPRYPCPDCEKSFVDKYTLKVHKRVHQ-----------PVEKPESAE--- 347
            :::|:.||...|:.:|||:.|..|.|||.::||||:|.:.|:           |.::.:..|   
  Fly   319 SRKTFNHHTLIHKENRPRHYCSVCPKSFTERYTLKMHMKTHEGDVVYGVREEAPADEQQVVEELH 383

  Fly   348 ----AKEATVT 354
                ..||.||
  Fly   384 VDVDESEAAVT 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 10/19 (53%)
C2H2 Zn finger 231..251 CDD:275368 12/19 (63%)
C2H2 Zn finger 259..308 CDD:275368 25/48 (52%)
C2H2 Zn finger 288..303 CDD:275370 5/14 (36%)
zf-C2H2 315..337 CDD:278523 10/21 (48%)
C2H2 Zn finger 317..337 CDD:275368 10/19 (53%)
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 81/155 (52%)
C2H2 Zn finger 225..245 CDD:275368 10/19 (53%)
C2H2 Zn finger 253..273 CDD:275368 12/19 (63%)
C2H2 Zn finger 281..301 CDD:275368 11/19 (58%)
C2H2 Zn finger 310..327 CDD:275370 6/16 (38%)
zf-C2H2 337..359 CDD:278523 10/21 (48%)
C2H2 Zn finger 339..359 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I11996
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019947
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.