DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and CG31365

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster


Alignment Length:214 Identity:57/214 - (26%)
Similarity:92/214 - (42%) Gaps:11/214 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 ERQPGEEDECEEFMKEEMLDEEFQFSEPDDSMPSSEEEFFTETTE-IPCHICGEMFSSQEVLER- 188
            |::..:.||.....::.  ..|..|.: :.|.|..:....|:|.: ..||:|...|.:|::|.| 
  Fly   406 EKEQNDRDEQTPLKRKR--SSELVFKQ-ESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRH 467

  Fly   189 ---HIKADTCQKSEQATCNVCGLKVKDDEVLDLHMNLHEGKTELECRYCDKKFSHKRNVLRHMEV 250
               |||.....|.....|..|.|::.....|..||.:|.|....:|..|:..||.:..:.|||:.
  Fly   468 HNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDT 532

  Fly   251 HWDKKKYQCDKCGERFSLSWLMYNHLMR-HDAEENALICEVCHQQFKTKRTYKHHLRTHQTDRPR 314
            |...|::||.:|...|:....:..|:.| |........|.:||:.|........||.||.  ...
  Fly   533 HTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHA--GVM 595

  Fly   315 YPCPDCEKSFVDKYTLKVH 333
            :.|..|.:.|.|:..::.|
  Fly   596 FSCKQCGRQFNDRSAVQRH 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 6/19 (32%)
C2H2 Zn finger 231..251 CDD:275368 7/19 (37%)
C2H2 Zn finger 259..308 CDD:275368 12/49 (24%)
C2H2 Zn finger 288..303 CDD:275370 4/14 (29%)
zf-C2H2 315..337 CDD:278523 5/19 (26%)
C2H2 Zn finger 317..337 CDD:275368 5/17 (29%)
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 22/75 (29%)
C2H2 Zn finger 485..505 CDD:275368 6/19 (32%)
zf-H2C2_2 497..522 CDD:290200 8/24 (33%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
zf-H2C2_2 526..550 CDD:290200 9/23 (39%)
C2H2 Zn finger 541..562 CDD:275368 5/20 (25%)
C2H2 Zn finger 571..591 CDD:275368 6/19 (32%)
C2H2 Zn finger 598..617 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446673
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.