DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and CG4424

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster


Alignment Length:346 Identity:85/346 - (24%)
Similarity:127/346 - (36%) Gaps:42/346 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CFVCGKEKSVGVFQLIEGCIVPGTFKPIKDI--LKYFEKIINQRLELLPNSAACRDCLEYLFNYD 70
            |...|:...|.:||..:..: ||.......|  |...:.....:.|:|| :..|..|..:|    
  Fly    14 CLQDGEAHMVSIFQTADDRL-PGGVSLCDKIESLSGIQIRATAKEEVLP-TRICLRCKAFL---- 72

  Fly    71 RLVRNLSQVQRQIADALLGCRQVEGKAETKQQAAKRARVQVPAFKIVQATALKEPERQPGEEDEC 135
                .|:...|||      |::  .....::...|.|..|....::||.|   .|...|..|.|.
  Fly    73 ----TLAHKFRQI------CQR--SNEFLREYVIKDAVEQGVVKEVVQQT---RPSTPPPIETEQ 122

  Fly   136 EEFMKEEMLDE-EFQFSEPDDSMPSSEEEFFTETTEIPCHICGEMFSSQEVLERHIKADT----- 194
            .|..::|:|:| .:...:|.:..|....|     .|.|..:..||..:    .....|.|     
  Fly   123 LEPPEDEVLEEGVWSTEDPIEETPHGPAE-----KERPTVLTVEMLPA----PYPPPASTPPPAP 178

  Fly   195 --CQKSEQATCNVCGLKVKDDEVLDLHMNLHEGKTELECRYCDKKFSHKRNVLRHMEVHWDKKKY 257
              ..|.:...|.:||........||.||..|..:...||..|.|.|.....:.||:..|...|.|
  Fly   179 AGAVKGKLHVCAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSFHVNYQLKRHIRQHTGAKPY 243

  Fly   258 QCDKCGERFSLSWLMYNHLMRHDAEENALICEVCHQQFKTKRTYKHHLRTHQTDRPRYPCPDCEK 322
            .|..|...|:....:..|...| ..|....|:.|.::|......|.|.:||..::| :.|..|.|
  Fly   244 TCQYCQRNFADRTSLVKHERTH-RNERPYACKTCGKKFTYASVLKMHYKTHTGEKP-HICQLCNK 306

  Fly   323 SFVDKYTLKVHKRVHQPVEKP 343
            ||...:.|..|.:..|.:..|
  Fly   307 SFARIHNLVAHLQTQQHINDP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 7/19 (37%)
C2H2 Zn finger 231..251 CDD:275368 6/19 (32%)
C2H2 Zn finger 259..308 CDD:275368 11/48 (23%)
C2H2 Zn finger 288..303 CDD:275370 3/14 (21%)
zf-C2H2 315..337 CDD:278523 7/21 (33%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
CG4424NP_650859.3 zf-AD 10..92 CDD:285071 20/95 (21%)
C2H2 Zn finger 189..209 CDD:275368 7/19 (37%)
DUF45 <204..281 CDD:302795 21/77 (27%)
COG5048 210..>345 CDD:227381 33/120 (28%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
C2H2 Zn finger 245..265 CDD:275368 4/19 (21%)
zf-H2C2_2 257..282 CDD:290200 6/25 (24%)
C2H2 Zn finger 273..293 CDD:275368 5/19 (26%)
zf-H2C2_2 286..310 CDD:290200 10/24 (42%)
C2H2 Zn finger 301..320 CDD:275368 7/18 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.