DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and su(Hw)

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001247098.1 Gene:su(Hw) / 41740 FlyBaseID:FBgn0003567 Length:941 Species:Drosophila melanogaster


Alignment Length:422 Identity:93/422 - (22%)
Similarity:149/422 - (35%) Gaps:143/422 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VCGKEKSVGVFQLIEGCIVPGTFKPIKDILKYFEKIINQRLELLPNSAACRDCLEYLFNYDRLVR 74
            ||||            |.  .||:.::.:.|:.|              .||....|......:::
  Fly   221 VCGK------------CY--KTFRRVQSLKKHLE--------------FCRYDSGYHLRKADMLK 257

  Fly    75 NLSQVQRQIADALLGCRQVEGK-----AETKQQAAKRARVQVPAFKIVQATALKEPERQPGEEDE 134
            ||.::::   ||::    :|.|     ............:..|                     :
  Fly   258 NLEKIEK---DAVV----MEKKDICFCCSESYDTFHLGHINCP---------------------D 294

  Fly   135 CEEFMKEEMLDEEFQF---SEPDDSMPSS---------------EEEFFTETTEIPCHICGEMFS 181
            |.:..|.:...|...|   ||..| .|.|               ||:..:......|.|||:.|:
  Fly   295 CPKSFKTQTSYERHIFITHSEFSD-FPCSICNANLRSEALLALHEEQHKSRGKPYACKICGKDFT 358

  Fly   182 SQEVLERHIKADTCQKSEQAT--CNVCG------------LK-------VKDDE----------- 214
            ....|:||.|..:|..:|..|  |.||.            ||       ||..|           
  Fly   359 RSYHLKRHQKYSSCSSNETDTMSCKVCDRVFYRLDNLRSHLKQHLGTQVVKKPEYMCHTCKNCFY 423

  Fly   215 ---VLDLHMNLHEGKTELECRYCDKKFSHKRNVLRHMEVHWDKKKYQCDKCGERFSLSWLMYNHL 276
               .|::|:..|.|:...:|..||||||....:.:|...|..:|.|.|..|.:.|::..::..|:
  Fly   424 SLSTLNIHIRTHTGEKPFDCDLCDKKFSALVALKKHRRYHTGEKPYSCTVCNQAFAVKEVLNRHM 488

  Fly   277 MRHDAEE-------------------------NALICEVCHQQFKTKRTYKHHLRTH-QTDRPRY 315
            .||..|.                         ....||.|.::|||::..:.|::|| :|.||.:
  Fly   489 KRHTGERPHKCDECGKSFIQATQLRTHSKTHIRPFPCEQCDEKFKTEKQLERHVKTHSRTKRPVF 553

  Fly   316 PCPDCEKSFVDKYTLKVH--KRVHQPVEKPES 345
            .|.:|:::|.....||.|  :..|.|.::..|
  Fly   554 SCAECKRNFRTPALLKEHMDEGKHSPKQQRSS 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 10/52 (19%)
C2H2 Zn finger 231..251 CDD:275368 8/19 (42%)
C2H2 Zn finger 259..308 CDD:275368 14/73 (19%)
C2H2 Zn finger 288..303 CDD:275370 6/14 (43%)
zf-C2H2 315..337 CDD:278523 6/23 (26%)
C2H2 Zn finger 317..337 CDD:275368 6/21 (29%)
su(Hw)NP_001247098.1 C2H2 Zn finger 292..313 CDD:275368 5/41 (12%)
COG5048 <312..517 CDD:227381 49/205 (24%)
C2H2 Zn finger 321..341 CDD:275368 3/19 (16%)
zf-C2H2 348..368 CDD:278523 8/19 (42%)
C2H2 Zn finger 350..368 CDD:275368 8/17 (47%)
C2H2 Zn finger 382..402 CDD:275368 5/19 (26%)
C2H2 Zn finger 415..435 CDD:275368 2/19 (11%)
zf-H2C2_2 428..451 CDD:290200 9/22 (41%)
C2H2 Zn finger 443..463 CDD:275368 8/19 (42%)
zf-H2C2_2 455..479 CDD:290200 6/23 (26%)
COG5048 <467..620 CDD:227381 30/119 (25%)
C2H2 Zn finger 471..491 CDD:275368 4/19 (21%)
zf-H2C2_2 484..508 CDD:290200 4/23 (17%)
C2H2 Zn finger 499..519 CDD:275368 0/19 (0%)
C2H2 Zn finger 525..545 CDD:275368 7/19 (37%)
C2H2 Zn finger 555..572 CDD:275368 5/16 (31%)
C2H2 Zn finger 598..615 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446715
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.