DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and l(3)neo38

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001262485.1 Gene:l(3)neo38 / 41423 FlyBaseID:FBgn0265276 Length:455 Species:Drosophila melanogaster


Alignment Length:144 Identity:34/144 - (23%)
Similarity:63/144 - (43%) Gaps:17/144 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 KVKDDEVLDLHMNLHEGKTELECRYCDKKFSHKRNVLRHMEVHWDKKKYQCDKCGERFSLSWLMY 273
            ::::.:.||       |.|...|..|...:..:..:.:|:..|..::::.||.|.......    
  Fly   290 EIRETKALD-------GSTLYCCPECQMAYPDRSLIEQHVISHAVERRFVCDICNAALKRK---- 343

  Fly   274 NHLMRHDAE---ENALICEVCHQQFKTKRTYKHHLRTHQTDRPRYPCPDCEKSFVDKYTLKVHKR 335
            :||.||...   :...:|.:|.:.||.|.....|:..|..:: ::.|.:|.|.|..|..|:.|.|
  Fly   344 DHLTRHKLSHIPDRPHVCNICMKSFKRKEQLTLHIVIHSGEK-KHVCIECGKGFYRKDHLRKHTR 407

  Fly   336 VH--QPVEKPESAE 347
            .|  :.|:...||:
  Fly   408 SHIARRVKSEVSAQ 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 2/13 (15%)
C2H2 Zn finger 231..251 CDD:275368 3/19 (16%)
C2H2 Zn finger 259..308 CDD:275368 13/51 (25%)
C2H2 Zn finger 288..303 CDD:275370 5/14 (36%)
zf-C2H2 315..337 CDD:278523 8/21 (38%)
C2H2 Zn finger 317..337 CDD:275368 8/19 (42%)
l(3)neo38NP_001262485.1 C2H2 Zn finger 305..325 CDD:275368 3/19 (16%)
zf-C2H2_8 306..391 CDD:292531 18/89 (20%)
C2H2 Zn finger 333..353 CDD:275368 7/23 (30%)
zf-H2C2_2 345..370 CDD:290200 7/24 (29%)
C2H2 Zn finger 361..381 CDD:275368 6/19 (32%)
zf-H2C2_2 374..398 CDD:290200 6/24 (25%)
C2H2 Zn finger 389..409 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4053
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.