DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and CG14710

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster


Alignment Length:287 Identity:69/287 - (24%)
Similarity:125/287 - (43%) Gaps:43/287 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KDILKYFEKIINQRLE--LLPNSAACRDCL-EYLFNY--DRLVRNLSQVQRQIADALLGCR---Q 92
            :::|.:...|||:.:|  ..||:.:....| .::.:|  |:.:..|...:.::.:.|....   :
  Fly   137 QEVLDFNGFIINESIEEDEEPNTESPEQILISHMDSYVDDQQMEELIDDKGELVEELSNANTFYE 201

  Fly    93 VE-GKAETKQQAAKRARVQVPAFKIVQATALKEPERQPGEEDECEEFMKEEMLDEEFQFSEPD-- 154
            || |..|....:|....   |:||:        .:::||         :....|.|.:|...|  
  Fly   202 VEYGDEELLMSSAPSPH---PSFKM--------DKQKPG---------RPRKPDAELKFKRKDIN 246

  Fly   155 ----DSMPSSEEEFFTETTEIPCHICGEMFSSQEVLERHIKADTCQKSEQATCNVCGLKVKDDEV 215
                .:.|..:||     .:..|.:||.:|..:.|...|:...:..|..|  |.:|....:....
  Fly   247 AKERGNQPKCKEE-----EKFMCILCGNVFYKKSVFTAHMMTHSEYKPHQ--CEICNKSFRQMGE 304

  Fly   216 LDLHMNLHEGKTELECRYCDKKFSHKRNVLRHMEVHWDKKKYQCDKCGERFSLSWLMYNHLMRHD 280
            |..|:..|.|....:|.|||:.|..:...:||..||.:.:.|.|.:||:.|:.:.::.||::.|.
  Fly   305 LRAHIRRHTGDRPYKCMYCDRHFYDRSERVRHERVHTNTRPYACQECGKTFTHTAILKNHILSHS 369

  Fly   281 AEENALICEVCHQQFKTKRTYKHHLRT 307
            |::| ..|.:|.:.|......|.||:|
  Fly   370 AQKN-YNCGICCKSFTLLHQLKAHLQT 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 4/19 (21%)
C2H2 Zn finger 231..251 CDD:275368 7/19 (37%)
C2H2 Zn finger 259..308 CDD:275368 16/49 (33%)
C2H2 Zn finger 288..303 CDD:275370 3/14 (21%)
zf-C2H2 315..337 CDD:278523
C2H2 Zn finger 317..337 CDD:275368
CG14710NP_650092.4 zf-AD 9..83 CDD:285071
COG5048 <261..395 CDD:227381 39/136 (29%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-C2H2 290..312 CDD:278523 5/23 (22%)
C2H2 Zn finger 292..312 CDD:275368 4/19 (21%)
zf-H2C2_2 304..327 CDD:290200 8/22 (36%)
C2H2 Zn finger 320..340 CDD:275368 7/19 (37%)
zf-H2C2_2 335..357 CDD:290200 9/21 (43%)
C2H2 Zn finger 348..368 CDD:275368 6/19 (32%)
C2H2 Zn finger 376..395 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446675
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.