DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and CG6791

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster


Alignment Length:371 Identity:86/371 - (23%)
Similarity:133/371 - (35%) Gaps:110/371 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EKII----------NQRLELLPNS--AACRDCLEYLFNYDRLVRNLSQVQRQIADALLGC-RQVE 94
            :|||          ..|:..||..  |.||.|.:...:...||::|:...|      :|. |::.
  Fly   561 DKIITNAYGIQNAQQHRITHLPFKAYARCRKCHKSYTDRKGLVKHLATHHR------VGWPRKLS 619

  Fly    95 GKAETK-QQAAKRARVQV-----PAFKIVQATALKEPERQPGEED-ECEEFMKEEMLDEEFQFSE 152
            |..... ...||:.|.|:     ..::|:.   |.:.::...||| :..|.|:.|  ::|:..:.
  Fly   620 GGCPAPILTPAKQPRKQIVTVANETYEIIY---LDDVDQGGMEEDNDFGEQMQAE--EDEYPIAP 679

  Fly   153 PDDSMPSSEEEFFTETTE-----IPCHICGEMFSSQEVLERHIKADTCQKS-------------- 198
            |..|.|...:    .||:     ..|..||.:|::|..:..||....|:|:              
  Fly   680 PPPSPPPPPQ----PTTQGNHQRYKCVHCGTLFATQAAVRVHISEKRCRKTVVRRRRQPVMSSAD 740

  Fly   199 ------EQ---ATCNVCGLKVKDDEVLDLHMNLHEGKTELECRYCDKKFSHKRNVLRHM-EVH-- 251
                  ||   ..|..||.               |.||:.|.|             ||: |||  
  Fly   741 PSVPTVEQNYIFLCPSCGF---------------EYKTQFEWR-------------RHINEVHNF 777

  Fly   252 ----------WDKKKYQCDKCGERFSLSWL--MYNHLMRHDAEENALICEVCHQQFKTKRTYKHH 304
                      .||.:|||.:|.:....|.|  :.:|..||......|.|.:|...:..|.....|
  Fly   778 DKRQYLNMRQLDKYRYQCTQCKDIVCNSKLKGLQDHHFRHLPYRLYLKCLICGTCYNHKPNIAAH 842

  Fly   305 LRTHQT--DRPRYPCPDCEKSFVDKYTLKVHKRVHQPVEKPESAEA 348
            ||...:  ||.........|..:.:|  |.:.|.:..:..|..|.|
  Fly   843 LRARHSIFDRETPTMITKPKQVLGRY--KDNSRENPKLPSPPPAPA 886

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 3/19 (16%)
C2H2 Zn finger 231..251 CDD:275368 4/20 (20%)
C2H2 Zn finger 259..308 CDD:275368 14/50 (28%)
C2H2 Zn finger 288..303 CDD:275370 3/14 (21%)
zf-C2H2 315..337 CDD:278523 4/21 (19%)
C2H2 Zn finger 317..337 CDD:275368 4/19 (21%)
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368
C2H2 Zn finger 208..230 CDD:275368
C2H2 Zn finger 235..256 CDD:275368
C2H2 Zn finger 516..532 CDD:275368
C2H2 Zn finger 557..580 CDD:275368 4/18 (22%)
C2H2 Zn finger 589..609 CDD:275368 6/19 (32%)
COG5236 <939..>1096 CDD:227561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.