DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and CG8478

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001163576.1 Gene:CG8478 / 41194 FlyBaseID:FBgn0037746 Length:576 Species:Drosophila melanogaster


Alignment Length:398 Identity:66/398 - (16%)
Similarity:132/398 - (33%) Gaps:147/398 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ILKYFEKIINQRLELLPNSAACRDCLEYLFNYDRLVRNLSQVQRQIADALLGCRQVE------GK 96
            :|:...::.|:.:.:|.:.|..          ::.|.::::|..::::.:....::.      ..
  Fly   205 VLENITEVSNEGVSMLVSPAGA----------EKEVAHVNEVVNEVSELIAKALKISADSVKPAT 259

  Fly    97 AETKQQAAKR-------------------------ARVQVPAFK----IVQATALKEPERQPG-- 130
            ::.|.:|.|:                         |..:..:||    :|..|.|..|.|:..  
  Fly   260 SKLKVEAGKKRQSMSSTYSGAALPRPRRSYLPTTTAETRTYSFKQRMSVVVKTTLNSPARKRSVG 324

  Fly   131 -----EEDEC-------EEFMKEEMLDEEFQFSEPDDSMPSSEEEFFTETTEIPCHICGEMFSSQ 183
                 ....|       :..:::.:.....:..|...|.|:.     |.|..||    .::||  
  Fly   325 GGVSLSRRSCLPVSKLTKSSIRKSLAVTSVRSPEKIASKPAK-----TSTKSIP----EKVFS-- 378

  Fly   184 EVLERHIKADTCQKSEQATCNVCGLKVKDDEVLDLHMNLHE-------------------GKTEL 229
                               |..|....:...:||:||.:|:                   |.::.
  Fly   379 -------------------CKNCSTTFRVKSLLDVHMRMHDPVDNGANTLKRLNSNPVAAGVSKN 424

  Fly   230 ECRYCDKKFSHKRNVLRHMEVHWDK-----------------KKYQCDKCGERFSLSWLMYNHLM 277
            .|::|||.|:.:|.:..|:..:.||                 ||.|..|.|....:     ||.|
  Fly   425 RCKFCDKNFALERALHIHLMQNCDKIPPSEKRKLEFTELNHEKKAQLPKIGGTSGI-----NHPM 484

  Fly   278 ---RHDAEENALICEVCHQQF-------KTKRTYKH--HLRTHQTDRPRYPCPDCEKSF-----V 325
               :...:..:.|.::...|.       ..|:..|:  |...::|.....||..|::||     .
  Fly   485 TMPQKPQQRISTIPKLAPSQGTQSMAPPSVKKIPKNVAHAGVYRTPTKTVPCHICKQSFRSILEF 549

  Fly   326 DKYTLKVH 333
            ..::|.||
  Fly   550 TNHSLTVH 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 6/19 (32%)
C2H2 Zn finger 231..251 CDD:275368 7/19 (37%)
C2H2 Zn finger 259..308 CDD:275368 10/60 (17%)
C2H2 Zn finger 288..303 CDD:275370 2/21 (10%)
zf-C2H2 315..337 CDD:278523 8/24 (33%)
C2H2 Zn finger 317..337 CDD:275368 7/22 (32%)
CG8478NP_001163576.1 zf-C2H2 377..399 CDD:278523 8/42 (19%)
C2H2 Zn finger 379..399 CDD:275368 6/19 (32%)
C2H2 Zn finger 426..444 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.