DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and CG8301

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster


Alignment Length:370 Identity:92/370 - (24%)
Similarity:139/370 - (37%) Gaps:86/370 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NQRLELLPNSA----ACRDCLEYL--FNYDRLVRNLSQVQ----------RQIADALLGCRQVEG 95
            |..|::.||..    .|.||....  .|..||....:|::          ..:.|..:|...:|.
  Fly    47 NWNLKISPNDGLPQKICSDCFTKFCSINAFRLACQEAQLKLSHIYDKIDASSLEDDEIGQEDLEP 111

  Fly    96 KAE------TKQQAAKRARVQV------PAFKIVQATALKEPERQPGEEDECEEFMKEEMLDEEF 148
            ..|      ||......|..|.      |....|.|..:.|.|    ||:|.||  :::..|||.
  Fly   112 AEEHQETETTKPTTTVSAETQPNNTASDPIEIFVDAVDIDEAE----EEEEEEE--QQQQYDEEV 170

  Fly   149 QFSEPDDSMPSSEEEFFTETTEIPCHIC---GEMFSSQEVLERHIKAD-------TCQKSE---- 199
            :....|:|.|..      .|....|..|   .|.:..|::|..||.|.       .|.:.|    
  Fly   171 EEPITDESAPPQ------LTISYACKFCLRPQENYQLQQLLLEHINASHDPEQPYNCPECEARFQ 229

  Fly   200 ----------------QATCNVCGLKVKDDEVLDLHMNLHEGKTELECRYCDKKFSHKRNVLRHM 248
                            |..|.|||.|..|...|..|:..:..:|:.||..|:|:|..::::..||
  Fly   230 DAASRTVHLKSSHVEKQHACGVCGKKYGDRHNLRHHVEKYHSETDFECALCEKRFYTRKSLNYHM 294

  Fly   249 EVHWDKKKYQCDKCG-ERFSLSWLMYNHLMRHDAEENALI------CEVCHQQFKTKRTYKHHL- 305
            :.|...::::|...| ||..:|   ..|||.|:|..:...      |..|.:.|...:|.:.|: 
  Fly   295 KWHNPDRQFKCRHSGCERLFIS---QRHLMCHEATHSGTSSRKSEHCGFCGKTFIHLKTLRWHIY 356

  Fly   306 RTHQTDRPRYPCPDCEKSFVDKYTLKVHKRVHQPVEKPESAEAKE 350
            |.|..::| |.|.:|.:.|..    ...||:|......|:..|.|
  Fly   357 RQHGGEKP-YKCANCTEVFAS----YAEKRIHMLERHRENLTAIE 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 8/19 (42%)
C2H2 Zn finger 231..251 CDD:275368 6/19 (32%)
C2H2 Zn finger 259..308 CDD:275368 16/56 (29%)
C2H2 Zn finger 288..303 CDD:275370 4/14 (29%)
zf-C2H2 315..337 CDD:278523 6/21 (29%)
C2H2 Zn finger 317..337 CDD:275368 5/19 (26%)
CG8301NP_649915.1 zf-AD 3..87 CDD:285071 11/39 (28%)
COG5048 198..>508 CDD:227381 53/207 (26%)
C2H2 Zn finger 221..241 CDD:275368 2/19 (11%)
C2H2 Zn finger 249..269 CDD:275368 8/19 (42%)
C2H2 Zn finger 277..297 CDD:275368 6/19 (32%)
C2H2 Zn finger 305..327 CDD:275368 10/24 (42%)
C2H2 Zn finger 338..359 CDD:275368 6/20 (30%)
C2H2 Zn finger 367..384 CDD:275368 5/20 (25%)
C2H2 Zn finger 400..420 CDD:275368
C2H2 Zn finger 451..471 CDD:275368
C2H2 Zn finger 480..500 CDD:275368
C2H2 Zn finger 508..528 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..582 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449771
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4053
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.880

Return to query results.
Submit another query.