DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and CG2678

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster


Alignment Length:442 Identity:91/442 - (20%)
Similarity:147/442 - (33%) Gaps:121/442 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSTRPFCFVCGKEKS--VGVFQLIEGCIVPGTFKPIKDILKYFEKIINQRLELLPNSAACRDCL 63
            |.|.:..|..|..|..  |.:|..:...::......:..||....:...:|.:||| ...|..|:
  Fly     2 MHSAKNVCRTCMDETGTLVDIFANVRDPVLDEPEMSLSHILARCTERPVKRGDLLP-QFICVSCV 65

  Fly    64 EYLFN-----------YDRLVRNLSQ---VQRQIADALLGC---------RQVEGKAETKQQAAK 105
            ..:.|           |....|.|:|   .:.|:  .|..|         ::::.|::.:|...:
  Fly    66 LAVQNAFRFKWQSEQSYQHFFRVLNQSGAPENQV--HLAACNGDKNQIINQKMQLKSDRQQDTQQ 128

  Fly   106 RARVQVPAFKIVQATALKEPERQPGEEDECEEFMKEEMLDEEFQFSEPDDSMPSSEEEFFTETTE 170
            ..:.|.|...:.|...| :.:.|.|..|...|...........:..|..|.:|...    |.:|:
  Fly   129 MTKTQKPDDDLSQKQTL-QAKLQEGNIDGPPESFTLHPRKRTCRTEEQADMIPKEA----TRSTK 188

  Fly   171 IPCHI--------CGEMFSSQEVLERHIKADTCQKSEQATCNVCGLKVKDDEVLDLHMNLHEGKT 227
            :.|..        |.:.|.||..|..|| .|.|.:     |..|.........|..|:..|..|.
  Fly   189 MICDADGYYNCPHCSKRFCSQTQLRTHI-TDLCNR-----CPYCPRTYMQKSNLKRHLRNHLSKP 247

  Fly   228 ELECRYCDKKFSHKRNVLRHMEVH----------------------------------------- 251
            ..:|.:|.|.|..|.::.||:..|                                         
  Fly   248 AHKCFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCSAVFIEHVQLEIHRREHKQRPGSSKSESTK 312

  Fly   252 ----------------WDKKKYQ--------------CDKCGERFSLSWLMYNHLMRHDAEENAL 286
                            |.|..:.              ||.|.::||..:.:..|::.|:.:.:..
  Fly   313 DPDSDDSDQAQDLKPKWTKNTFNGTCSIPPMLKPKPICDICQKKFSSVYALKRHMLTHNRQHHLK 377

  Fly   287 ICEVCHQQFKTKRTYKHHLRTHQTDRPRYPCPDCEKSFVDKYTLKVH-KRVH 337
            .|..|.::|||::..|.|.|.|..|  .:.|..|...|||...|:.| ||:|
  Fly   378 KCTYCSEEFKTEKHLKRHERGHMGD--LFRCEFCSLVFVDVNYLRKHKKRIH 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 4/19 (21%)
C2H2 Zn finger 231..251 CDD:275368 7/19 (37%)
C2H2 Zn finger 259..308 CDD:275368 15/48 (31%)
C2H2 Zn finger 288..303 CDD:275370 5/14 (36%)
zf-C2H2 315..337 CDD:278523 9/22 (41%)
C2H2 Zn finger 317..337 CDD:275368 9/20 (45%)
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 15/77 (19%)
COG5048 220..>284 CDD:227381 15/68 (22%)
C2H2 Zn finger 223..243 CDD:275368 4/19 (21%)
zf-C2H2 249..271 CDD:278523 7/21 (33%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
C2H2 Zn finger 279..299 CDD:275368 0/19 (0%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
C2H2 Zn finger 406..427 CDD:275368 9/20 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.