Sequence 1: | NP_001303451.1 | Gene: | Sry-beta / 43570 | FlyBaseID: | FBgn0003511 | Length: | 356 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_649316.1 | Gene: | Neu2 / 40375 | FlyBaseID: | FBgn0037085 | Length: | 382 | Species: | Drosophila melanogaster |
Alignment Length: | 262 | Identity: | 64/262 - (24%) |
---|---|---|---|
Similarity: | 96/262 - (36%) | Gaps: | 59/262 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 113 AFKIVQATALKEPERQPGEEDECEEFMKE--------EMLDEEFQF-----------SEPDDSMP 158
Fly 159 SSEEEFFTETTEIPCHICGEMFSSQEVLERHIK--ADTCQKSEQATCNVCGLKVKD--------- 212
Fly 213 ------DEVLDLHMNLHEGKTELECRYCDKKFSHKRNVLRHMEVHWDKKKYQCDKCGERFSLSWL 271
Fly 272 MYNHLMRHDAEENALICEVCHQQFKTKRTYKHHLRTHQTDRPRYPCPDCEKSFVDKYTLKVHKRV 336
Fly 337 HQ 338 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sry-beta | NP_001303451.1 | C2H2 Zn finger | 203..223 | CDD:275368 | 7/34 (21%) |
C2H2 Zn finger | 231..251 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 259..308 | CDD:275368 | 13/48 (27%) | ||
C2H2 Zn finger | 288..303 | CDD:275370 | 4/14 (29%) | ||
zf-C2H2 | 315..337 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 317..337 | CDD:275368 | 8/19 (42%) | ||
Neu2 | NP_649316.1 | zf-AD | 1..63 | CDD:285071 | 8/46 (17%) |
COG5048 | <119..241 | CDD:227381 | 34/123 (28%) | ||
C2H2 Zn finger | 121..141 | CDD:275368 | 3/19 (16%) | ||
zf-H2C2_2 | 133..158 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 149..169 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 162..185 | CDD:290200 | 6/22 (27%) | ||
C2H2 Zn finger | 177..197 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 205..225 | CDD:275368 | 7/19 (37%) | ||
zf-C2H2_8 | 206..286 | CDD:292531 | 21/50 (42%) | ||
C2H2 Zn finger | 233..253 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 260..297 | CDD:275368 | |||
C2H2 Zn finger | 303..323 | CDD:275368 | |||
C2H2 Zn finger | 353..373 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45446571 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24409 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |