DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and CG10654

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster


Alignment Length:315 Identity:67/315 - (21%)
Similarity:118/315 - (37%) Gaps:101/315 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 RDCLEYLFNYDRLVRNLSQVQRQIADALLGCRQVEG--------KAETKQQAAKRARVQVPAFKI 116
            |.|.|.|.|:::|::::.          :||.::|.        .:|:.:.....|:...|....
  Fly   103 RMCAESLRNFEKLLQDID----------IGCHKLEDHTWHDLDTPSESNESTNPEAQSHAPCIAA 157

  Fly   117 VQATALKEPERQPGEEDECEEFMKEEMLDEEFQFSEPDDSMP------------SSEEEFFTETT 169
            .|                           |...|..|...:|            |.|||.:.   
  Fly   158 TQ---------------------------EIVSFIWPQVCLPLAVILSRITLGASLEEEVYV--- 192

  Fly   170 EIPCHICGEMFSSQEVLERHIKADTCQKSEQATCNVCGLKVKDDEVLDLHMNLHEG-KTELECRY 233
                           :.:...|.|..|:....:..:.|.:.:            .| :..||||.
  Fly   193 ---------------IEDESAKQDLGQEKLSISSKLLGARKR------------RGVRHTLECRI 230

  Fly   234 CDKKFSHKRNVLR-HMEVHWDKKKYQCDKCGERFSLSWLMYNHL--MRHDAEENALI--CEVCHQ 293
            |.:.| :|.::|. ||:.|...:.|.|..|.:.::.:.|:.:||  |.::|:...:|  |..|::
  Fly   231 CHRGF-YKPSLLEAHMQQHEGLRPYTCVHCAKSYARANLLESHLRQMHNNADAARIIYACPSCNK 294

  Fly   294 QFKTKRTYKHHLRT-----HQTDRP--RYPCPDCEKSFVDKYTLKVHKRVHQPVE 341
            .:...|:.|:|:|.     |:::.|  |:.|.:|.|.|..|..|..||.||..||
  Fly   295 VYTANRSLKYHMRRTHERYHESESPDARHICEECGKCFARKAHLTRHKMVHGSVE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 1/19 (5%)
C2H2 Zn finger 231..251 CDD:275368 8/20 (40%)
C2H2 Zn finger 259..308 CDD:275368 14/57 (25%)
C2H2 Zn finger 288..303 CDD:275370 3/14 (21%)
zf-C2H2 315..337 CDD:278523 8/21 (38%)
C2H2 Zn finger 317..337 CDD:275368 8/19 (42%)
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 5/11 (45%)
C2H2 Zn finger 228..248 CDD:275368 8/20 (40%)
C2H2 Zn finger 256..313 CDD:275368 14/56 (25%)
C2H2 Zn finger 289..314 CDD:275368 6/24 (25%)
zf-C2H2 323..345 CDD:278523 8/21 (38%)
C2H2 Zn finger 325..345 CDD:275368 8/19 (42%)
C2H2 Zn finger 355..376 CDD:275368
C2H2 Zn finger 385..405 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.