DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and CG10543

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001369100.1 Gene:CG10543 / 37379 FlyBaseID:FBgn0034570 Length:1666 Species:Drosophila melanogaster


Alignment Length:247 Identity:68/247 - (27%)
Similarity:114/247 - (46%) Gaps:32/247 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PGEEDEC--------EEFM--KEEMLDEEFQF-SEPDDSMPSSEEEFFT--------ETTEIPCH 174
            ||...:|        ||.:  ...|..:||.| .|......|.:::|..        |....||.
  Fly   748 PGYCHDCGQRNGNTLEEIIHHNRTMHVKEFPFVCETCGESYSRKQQFHAHVESHNKKEIKTFPCG 812

  Fly   175 ICGEMFSSQEVLERHIKADTCQKSEQATCNVCGLKVKDDEVLDLH-MNLHEGKTELECRYCDKKF 238
            .||..| .|:.|::|.: :|..|::.|.|.|||.:.:....|..| :.:|:.....||..|..:|
  Fly   813 ECGLKF-PQKKLQQHFE-ETGHKADGAICEVCGEEFQSKNALYQHIIRVHKRDNFFECHICHNRF 875

  Fly   239 SHKRNVLRHMEVHWD-KKKYQCDKCGERFSLSWLMYNHLMRHDAEENALI----CEVCHQQFKTK 298
            :.|.|:.||:::|.: |:.|.||.||.    |:..|..|..|.:..:..:    |.:|.::|.:.
  Fly   876 TLKANLERHVQLHTEIKRPYVCDLCGS----SYFTYPALKEHYSNAHVDVSECKCTLCGKRFGSA 936

  Fly   299 RTYKHHLRTHQTDRPRYPCPDCEKSFVDKYTLKVHKRVHQPVEKPESAEAKE 350
            ::.:.||.:|..:|| :.|..|:::|..|..|..||:.....|.|...:.|:
  Fly   937 KSLQRHLPSHSEERP-HCCNYCDQTFKWKTHLVRHKQTMHGNEPPPPKKGKQ 987

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 6/20 (30%)
C2H2 Zn finger 231..251 CDD:275368 7/19 (37%)
C2H2 Zn finger 259..308 CDD:275368 13/52 (25%)
C2H2 Zn finger 288..303 CDD:275370 3/14 (21%)
zf-C2H2 315..337 CDD:278523 7/21 (33%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
CG10543NP_001369100.1 C2H2 Zn finger 727..747 CDD:275368
C2H2 Zn finger 751..773 CDD:275368 3/21 (14%)
C2H2 Zn finger 781..801 CDD:275368 3/19 (16%)
PHA00733 <804..860 CDD:177301 18/57 (32%)
C2H2 Zn finger 811..827 CDD:275368 6/16 (38%)
C2H2 Zn finger 839..860 CDD:275368 6/20 (30%)
C2H2 Zn finger 868..888 CDD:275368 7/19 (37%)
C2H2 Zn finger 897..913 CDD:275368 7/19 (37%)
C2H2 Zn finger 926..946 CDD:275368 5/19 (26%)
C2H2 Zn finger 954..975 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.