DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and CG31612

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001163042.1 Gene:CG31612 / 35427 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster


Alignment Length:300 Identity:67/300 - (22%)
Similarity:121/300 - (40%) Gaps:53/300 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LVRNLSQVQRQIADALLGCRQVEGKAETKQQAAKRARVQVPAFKI-------VQATALKEPERQP 129
            |.|....:.|...|..|..|:.......||:|..:..:..|..:|       ::.|....|.::.
  Fly   555 LARYFCAICRLEFDNSLDARRHRSLVIHKQKARPQTSIPQPENEIEHMLREVLEETVPSPPAKRS 619

  Fly   130 GEED-ECEEFMKEEMLDEEFQFSEPDDSMPSSEEEFFTETTEIPCHICGEMFSSQEVLERHIKA- 192
            .:.: :|....|  .::...:.::....:.||:...        |..||..|.|.:.|.||.:: 
  Fly   620 ADVNAKCSNSRK--TIESSQRLAQHQAEVHSSDNHL--------CLSCGISFESAQALGRHTRSC 674

  Fly   193 ------------DTCQKSEQATCNVCGLKVKDDEVLDLHMNLHE-----GKTE-LECRYCDKKFS 239
                        ...||....:|:.|..:.:.:..|..|...|.     ||.| |:|..|.|.| 
  Fly   675 QPLASTSTPADLSQAQKKSMYSCDQCRFQSQYESDLVYHRIFHTRSGTIGKNEVLQCPLCPKNF- 738

  Fly   240 HKRNVLR-HMEVHWDKKKYQCDKCGERFSLSWLMYNHLMRHDAEENALICEVCHQQFKTKRTYKH 303
             |::.|| |:..|.::|.::|.:|.::|:....:.||::..            |.:...|...|:
  Fly   739 -KKHSLRAHLRNHTNEKIFECTECLQKFARRHNLKNHVITK------------HAKVGDKEKKKY 790

  Fly   304 HLRTHQTDRPRYPCPDCEKSFVDKYTLKVHKRVH-QPVEK 342
            ..:..:..:|:|.|..|.|....||:||:|:..| :.||:
  Fly   791 AAKDVEQSKPKYQCGTCGKLLAKKYSLKLHEISHSKAVER 830

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 4/19 (21%)
C2H2 Zn finger 231..251 CDD:275368 8/20 (40%)
C2H2 Zn finger 259..308 CDD:275368 8/48 (17%)
C2H2 Zn finger 288..303 CDD:275370 2/14 (14%)
zf-C2H2 315..337 CDD:278523 9/21 (43%)
C2H2 Zn finger 317..337 CDD:275368 8/19 (42%)
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 4/19 (21%)
C2H2 Zn finger 731..750 CDD:275368 8/20 (40%)
C2H2 Zn finger 758..779 CDD:275368 5/32 (16%)
C2H2 Zn finger 804..824 CDD:275368 8/19 (42%)
C2H2 Zn finger 834..856 CDD:275368
C2H2 Zn finger 898..918 CDD:275368
zf-H2C2_2 910..935 CDD:290200
C2H2 Zn finger 926..945 CDD:275368
C2H2 Zn finger 957..984 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.