Sequence 1: | NP_001303451.1 | Gene: | Sry-beta / 43570 | FlyBaseID: | FBgn0003511 | Length: | 356 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_476601.1 | Gene: | wor / 34906 | FlyBaseID: | FBgn0001983 | Length: | 548 | Species: | Drosophila melanogaster |
Alignment Length: | 486 | Identity: | 87/486 - (17%) |
---|---|---|---|
Similarity: | 145/486 - (29%) | Gaps: | 209/486 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 DILKYFEKIINQRLELLPNSAACRDCLEYLFNYDRLVRNLSQVQRQIADALLGCRQVEGKAETKQ 101
Fly 102 QAAKR-ARVQVPAFKIVQATALKEPE---------------------RQPGEED----------- 133
Fly 134 -----ECEEFMKEEMLDEEF--------------QFSEPDD-----------------------S 156
Fly 157 M---------PSSEEEFFTETTEI-------------PCHICGEMFSSQEVLERHIKADTCQKSE 199
Fly 200 -----------------------QAT------------------------CNVCGLKVKDDEVLD 217
Fly 218 LHMNLH----EG---KTELECRYCDKKFSHKRNVLRHMEVHWDKKKYQCDKCGERFSLSWLMYNH 275
Fly 276 LMRHDAEENALICEVCHQQFKTKRTYKHHLRTHQTDRPRYPCPDCEKSF---------------- 324
Fly 325 ------------VDKYTLKVHKRVHQPVEKP 343 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sry-beta | NP_001303451.1 | C2H2 Zn finger | 203..223 | CDD:275368 | 5/19 (26%) |
C2H2 Zn finger | 231..251 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 259..308 | CDD:275368 | 14/48 (29%) | ||
C2H2 Zn finger | 288..303 | CDD:275370 | 3/14 (21%) | ||
zf-C2H2 | 315..337 | CDD:278523 | 10/49 (20%) | ||
C2H2 Zn finger | 317..337 | CDD:275368 | 9/47 (19%) | ||
wor | NP_476601.1 | C2H2 Zn finger | 270..290 | CDD:275368 | 4/19 (21%) |
C2H2 Zn finger | 317..334 | CDD:275368 | 2/16 (13%) | ||
zf-C2H2 | 345..367 | CDD:278523 | 5/21 (24%) | ||
C2H2 Zn finger | 347..367 | CDD:275368 | 5/19 (26%) | ||
PHA00732 | 379..>417 | CDD:177300 | 10/39 (26%) | ||
C2H2 Zn finger | 382..402 | CDD:275368 | 5/19 (26%) | ||
zf-C2H2_8 | 405..482 | CDD:292531 | 24/78 (31%) | ||
zf-C2H2 | 406..428 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 408..428 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 421..444 | CDD:290200 | 5/23 (22%) | ||
zf-C2H2 | 434..456 | CDD:278523 | 4/21 (19%) | ||
C2H2 Zn finger | 436..456 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 448..473 | CDD:290200 | 11/25 (44%) | ||
C2H2 Zn finger | 464..481 | CDD:275368 | 6/16 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24409 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |