DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and wor

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_476601.1 Gene:wor / 34906 FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster


Alignment Length:486 Identity:87/486 - (17%)
Similarity:145/486 - (29%) Gaps:209/486 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DILKYFEKIINQRLELLPNSAACRDCLEYLFNYDRLVRNLSQVQRQIADALLGCRQVEGKAETKQ 101
            ::.:.|:..:||..|                   :|.|.:.:..|:||.|.       ....|::
  Fly    63 ELRRRFDAAMNQTKE-------------------QLARRIWEETREIARAF-------PDVFTRE 101

  Fly   102 QAAKR-ARVQVPAFKIVQATALKEPE---------------------RQPGEED----------- 133
            :.||. ||:....|::.....:.|||                     .:|.:|:           
  Fly   102 EIAKSLARLGYGEFELPPEEEVMEPEPEPEQHLPLRYTRDASPTIIKAEPSDEEQFPLRNYNNNL 166

  Fly   134 -----ECEEFMKEEMLDEEF--------------QFSEPDD-----------------------S 156
                 |.|:.||.:.:.||.              ..:||:|                       |
  Fly   167 LKSIAEYEDCMKMQNIKEEIPPIPSPQLFYPPPTPLAEPEDLSVTQRRVLSENMNLQNVARALLS 231

  Fly   157 M---------PSSEEEFFTETTEI-------------PCHICGEMFSSQEVLERHIKADTCQKSE 199
            |         |..:.|...|..:|             .|..|.:.:::...|.:|.:....:.:|
  Fly   232 MQHMAPQHAPPPIDMEEDQENQDINQLKIKSSNDLYYQCQQCNKCYATYAGLVKHQQTHAYESTE 296

  Fly   200 -----------------------QAT------------------------CNVCGLKVKDDEVLD 217
                                   ||:                        |..||........|.
  Fly   297 YKIIRSQPGGSGAIVDQTEFCTDQASALIQAANVASAQSMQKPVGVPRYHCQDCGKSYSTYSGLS 361

  Fly   218 LHMNLH----EG---KTELECRYCDKKFSHKRNVLRHMEVHWDKKKYQCDKCGERFSLSWLMYNH 275
            .|...|    ||   |....|:.|||.:.....:..|:..|  ....:|..||:.||..||:..|
  Fly   362 KHQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTH--TLPCKCPICGKAFSRPWLLQGH 424

  Fly   276 LMRHDAEENALICEVCHQQFKTKRTYKHHLRTHQTDRPRYPCPDCEKSF---------------- 324
            :..|..|: ...|:.|::.|..:...:.|::|| :|..:|.||.|.|||                
  Fly   425 IRTHTGEK-PFSCQHCNRAFADRSNLRAHMQTH-SDVKKYSCPTCTKSFSRMSLLAKHLQSGCQT 487

  Fly   325 ------------VDKYTLKVHKRVHQPVEKP 343
                        .|:..|:.|.:|::....|
  Fly   488 EQSGGPSGSGGGFDQQQLQQHLQVYEEGHNP 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 5/19 (26%)
C2H2 Zn finger 231..251 CDD:275368 5/19 (26%)
C2H2 Zn finger 259..308 CDD:275368 14/48 (29%)
C2H2 Zn finger 288..303 CDD:275370 3/14 (21%)
zf-C2H2 315..337 CDD:278523 10/49 (20%)
C2H2 Zn finger 317..337 CDD:275368 9/47 (19%)
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 4/19 (21%)
C2H2 Zn finger 317..334 CDD:275368 2/16 (13%)
zf-C2H2 345..367 CDD:278523 5/21 (24%)
C2H2 Zn finger 347..367 CDD:275368 5/19 (26%)
PHA00732 379..>417 CDD:177300 10/39 (26%)
C2H2 Zn finger 382..402 CDD:275368 5/19 (26%)
zf-C2H2_8 405..482 CDD:292531 24/78 (31%)
zf-C2H2 406..428 CDD:278523 8/21 (38%)
C2H2 Zn finger 408..428 CDD:275368 8/19 (42%)
zf-H2C2_2 421..444 CDD:290200 5/23 (22%)
zf-C2H2 434..456 CDD:278523 4/21 (19%)
C2H2 Zn finger 436..456 CDD:275368 4/19 (21%)
zf-H2C2_2 448..473 CDD:290200 11/25 (44%)
C2H2 Zn finger 464..481 CDD:275368 6/16 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.