DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and crol

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001245993.1 Gene:crol / 34592 FlyBaseID:FBgn0020309 Length:962 Species:Drosophila melanogaster


Alignment Length:360 Identity:85/360 - (23%)
Similarity:137/360 - (38%) Gaps:78/360 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QRLELLPNSA-------ACRDCLE-YLFNYDRLVRNLSQVQRQIADALLGCRQVEGKA-ETKQQA 103
            |.:.|.|:..       .|..|.: :.|.|..:|......:|:    ...| ||.|:. .|.|..
  Fly   205 QNVALAPDGTPIATGTHVCDICGKMFQFRYQLIVHRRYHSERK----PFMC-QVCGQGFTTSQDL 264

  Fly   104 AKRARVQV--PAFKIV-------QATALKEPERQPGEEDE-----CEE-FMKEEMLDEEFQFSEP 153
            .:..::.:  |.|..:       ..|:|:...::...:..     |:: |.::|.||..|:    
  Fly   265 TRHGKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFR---- 325

  Fly   154 DDSMPSSEEEFFTETTEIP--CHICGEMFSSQEVLERHI---------KADTCQKS--------- 198
                        :.|.|.|  |..|.:.|:.:|.:..|:         :.|.|:||         
  Fly   326 ------------SHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVN 378

  Fly   199 --------EQATCNVCGLKVKDDEVLDLHMNLHEGKTELECRYCDKKFSHKRNVLRHMEVHWDKK 255
                    ....|:|||.|....|.|..||..|..:|...|..|.|.||.|.:...|:..|..:.
  Fly   379 HYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGET 443

  Fly   256 KYQCDKCGERFSLSWLMYNHLMRHDAEENALICEVCHQQFKTKRTYKHHLRTHQTDRPRYPCPDC 320
            .::||.|.:.|:....:.||:.:|.. |:...|..|.:.|..|....:|:|.|..:.| :.|..|
  Fly   444 PHRCDFCSKTFTRKEHLLNHVRQHTG-ESPHRCSYCMKTFTRKEHLVNHIRQHTGETP-FKCTYC 506

  Fly   321 EKSFVDKYTLKVHKRVHQPVEKPESAEAKEATVTF 355
            .|:|..|..:..|.|.|.. |.|.  :....|.||
  Fly   507 TKAFTRKDHMVNHVRQHTG-ESPH--KCTYCTKTF 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 9/19 (47%)
C2H2 Zn finger 231..251 CDD:275368 7/19 (37%)
C2H2 Zn finger 259..308 CDD:275368 14/48 (29%)
C2H2 Zn finger 288..303 CDD:275370 4/14 (29%)
zf-C2H2 315..337 CDD:278523 7/21 (33%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
crolNP_001245993.1 C2H2 Zn finger 223..243 CDD:275368 5/19 (26%)
C2H2 Zn finger 251..271 CDD:275368 6/20 (30%)
C2H2 Zn finger 279..299 CDD:275368 2/19 (11%)
COG5048 300..723 CDD:227381 66/260 (25%)
C2H2 Zn finger 307..327 CDD:275368 6/35 (17%)
C2H2 Zn finger 335..355 CDD:275368 5/19 (26%)
C2H2 Zn finger 363..383 CDD:275368 4/19 (21%)
C2H2 Zn finger 391..411 CDD:275368 9/19 (47%)
C2H2 Zn finger 419..439 CDD:275368 7/19 (37%)
C2H2 Zn finger 447..467 CDD:275368 6/19 (32%)
C2H2 Zn finger 475..495 CDD:275368 6/19 (32%)
C2H2 Zn finger 503..523 CDD:275368 7/19 (37%)
C2H2 Zn finger 531..551 CDD:275368 3/8 (38%)
C2H2 Zn finger 559..579 CDD:275368
C2H2 Zn finger 587..607 CDD:275368
C2H2 Zn finger 615..636 CDD:275368
C2H2 Zn finger 644..664 CDD:275368
C2H2 Zn finger 676..696 CDD:275368
C2H2 Zn finger 704..722 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446674
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.