DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and CG17612

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_608824.1 Gene:CG17612 / 33639 FlyBaseID:FBgn0031597 Length:618 Species:Drosophila melanogaster


Alignment Length:412 Identity:92/412 - (22%)
Similarity:142/412 - (34%) Gaps:102/412 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QLIEGCIVPGTFKPIKDILKYFEKIINQRLELLPNSAACRDCLEYLFNYDRLVRNLSQVQRQIAD 85
            :.|||..:.|         :||  ||.:.|| .|...:||.|||...|...:..:..|....||.
  Fly   161 EAIEGEDLQG---------EYF--IITECLE-EPAIGSCRVCLEQSDNLTNIFDDAHQYGIPIAT 213

  Fly    86 ALLGCRQVEGKAETKQQAAKRARVQVPAFKIVQATALKEPE---------RQPGEE--DECEEFM 139
            .|   .|..|....|..:... .:.|....:|: .|..:.|         |||.||  |.....:
  Fly   214 IL---SQYTGMPVEKGDSFSE-YICVTCLDVVK-NAFDDLESKENTIQMYRQPKEEIIDIDSIPV 273

  Fly   140 KEEMLDEEFQFSEPDDSMPSSEEEFF--------------TETTEIP------------------ 172
            |.:.:|.|.. .:|....|...:.|.              |.|||.|                  
  Fly   274 KNKPVDYEVT-GKPPHRCPQCPKIFLLAAKLQAHIRTHNETRTTEPPRLKCPMCPSIYMKRGCLE 337

  Fly   173 ---------------------CHICGEMFSSQEVLERHIKA--DTCQKSEQAT---CNVCGLKVK 211
                                 |..|.::|.....||.||:.  |..|:..:.:   |..|.....
  Fly   338 AHMWIHRASDERESELEPPYRCPHCPKLFLYSSFLEIHIQTHEDVSQRLSRKSSHKCAQCADVFS 402

  Fly   212 DDEVLDLHMNLHEGKTELECRYCDKKFSHKRNVLRHMEVHWDKKKYQCDKCGERFSLSWLMYNHL 276
            |...|..|:.:|.|:...:|..|...|..:.|:..|...|   .:::|.||.:.|.....:..|.
  Fly   403 DVSSLKDHVKIHAGERTFKCPLCLMSFQEESNLKSHDCAH---TRFKCHKCSKFFESQNYLDFHF 464

  Fly   277 MRHDAEENALICEVCHQQFKTKRTYKHHLRTH------QTDRPR--YPCPDCEKSF--VDKYTL- 330
            .:....:....|..|.|.|:.:...|.|:.:.      ::..|.  :|||.|.|.|  .|.|.: 
  Fly   465 KKSHTTKGPFKCIKCQQTFQKRNGLKEHISSQVCVQFLRSKSPGQIFPCPKCPKKFSIEDNYQMH 529

  Fly   331 -KVHKRVHQPVEKPESAEAKEA 351
             ..||:|...:|:....:.|::
  Fly   530 HATHKKVKTVIERHNCTQCKKS 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 5/19 (26%)
C2H2 Zn finger 231..251 CDD:275368 5/19 (26%)
C2H2 Zn finger 259..308 CDD:275368 11/48 (23%)
C2H2 Zn finger 288..303 CDD:275370 4/14 (29%)
zf-C2H2 315..337 CDD:278523 10/25 (40%)
C2H2 Zn finger 317..337 CDD:275368 9/23 (39%)
CG17612NP_608824.1 zf-AD 187..>246 CDD:285071 16/63 (25%)
C2H2 Zn finger 290..310 CDD:275368 2/19 (11%)
C2H2 Zn finger 323..343 CDD:275370 0/19 (0%)
zf-C2H2_8 356..438 CDD:292531 20/81 (25%)
C2H2 Zn finger 359..379 CDD:275368 7/19 (37%)
C2H2 Zn finger 394..414 CDD:275368 5/19 (26%)
C2H2 Zn finger 422..438 CDD:275368 4/15 (27%)
C2H2 Zn finger 447..463 CDD:275368 4/15 (27%)
C2H2 Zn finger 476..505 CDD:275368 6/28 (21%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
C2H2 Zn finger 545..565 CDD:275368 1/7 (14%)
C2H2 Zn finger 568..584 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449788
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.