DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and CG9609

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster


Alignment Length:265 Identity:63/265 - (23%)
Similarity:98/265 - (36%) Gaps:57/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 TALKEPERQPGEED------------ECE-EFMKEEMLDEEFQFSEPDDSMPSSEEEFFTETTEI 171
            |||:|.:::.|..:            :|| .|.:.:.||.              .|...|...:.
  Fly    15 TALEEFKQRQGRRNSIGSAKYACSMPKCEATFKRLDQLDR--------------HEYHHTGIKKH 65

  Fly   172 PCHI--CGEMFSSQEVLERHIKADTCQKSEQAT----------CNVCGLKVKDDEVLDLHM-NLH 223
            .|..  |.:.:|....|:||::: |.::.|.|.          |:...:.|.:   :..|| ..|
  Fly    66 ACSYEGCDKTYSIVTHLKRHLRS-THERPESAAKKTVKCALEECSKMFISVSN---MTRHMRETH 126

  Fly   224 EGKTELECRYCDKKFSHKRNVLRH-MEVHWDKKKYQCDKCGERFSLSWLMYNHLMRHDAEENALI 287
            |......|..|..|||.|..:.|| :..|..:..|.|.||...|...|...:|      |.:..:
  Fly   127 ESPKVYPCSQCSAKFSQKLKLKRHEIREHTLEYPYSCSKCSRGFYQQWQCQSH------EPSCKL 185

  Fly   288 --CEVCHQQFKTKRTYKHHLRTHQTDRPRYPCPDCEKSFVDKYTLKVHKRVHQPVEKPESAEAKE 350
              |..|..||.....|..|.|.....:.|:.|..|:.:|.....||.|..    |:..|:|:..|
  Fly   186 YECPGCPLQFDKWTLYTKHCRDSLHGKNRHKCDRCDSAFDKPSELKRHLE----VKHKEAAQTDE 246

  Fly   351 ATVTF 355
            ...:|
  Fly   247 CATSF 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 4/20 (20%)
C2H2 Zn finger 231..251 CDD:275368 8/20 (40%)
C2H2 Zn finger 259..308 CDD:275368 14/50 (28%)
C2H2 Zn finger 288..303 CDD:275370 5/14 (36%)
zf-C2H2 315..337 CDD:278523 6/21 (29%)
C2H2 Zn finger 317..337 CDD:275368 6/19 (32%)
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368 6/32 (19%)
zf-C2H2_8 67..150 CDD:292531 21/86 (24%)
C2H2 Zn finger 67..90 CDD:275368 6/23 (26%)
C2H2 Zn finger 106..126 CDD:275368 4/22 (18%)
C2H2 Zn finger 134..155 CDD:275368 8/20 (40%)
C2H2 Zn finger 188..210 CDD:275368 7/21 (33%)
C2H2 Zn finger 217..237 CDD:275368 6/23 (26%)
C2H2 Zn finger 253..276 CDD:275368
C2H2 Zn finger 283..302 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.