DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and CG18262

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster


Alignment Length:425 Identity:87/425 - (20%)
Similarity:153/425 - (36%) Gaps:126/425 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CIVPGTFKPIKDILKYFEKIINQRLELLPNSAA--CRDCLEYLFNYDRLVRNLSQVQ--RQIADA 86
            |::.....|:....::|      ||:...||::  |.:.||    .|.:.:::.:||  .::.:.
  Fly    34 CLLCDQRLPLDGYPEHF------RLKHFTNSSSSLCSNELE----SDPIAQDVVEVQGNEELHEE 88

  Fly    87 LL--GCRQVEGKAETKQQAAKRARVQVPAFKIVQATALK-------------EPERQPGEEDECE 136
            |.  ....:|.:.|.|::.:||...|       :|.|:|             |.:...||:.|..
  Fly    89 LAKEASPDLEEEEEEKEEGSKRQHYQ-------RAAAMKNTLVETREDLLDIELDWTGGEQSEHN 146

  Fly   137 EFMKEEMLDEEFQFSEPDDSMPSSEEEFFTETTEIPCHICGEMFSSQEVLE-----RHIKADTCQ 196
            |..:||..:     |:.||:..|::    |:.....|..|...::::..|:     :|.:|:...
  Fly   147 ETHEEEEGE-----SDDDDTKDSND----TKDMLFQCDQCDRAYNTKRSLQSHRRLKHSEANGGS 202

  Fly   197 KSEQAT---------------CN--VCGLKVKDDEVLDLHMNLHEGKTELECRYCDKKFSHKRNV 244
            ..:.|:               ||  .|....:.:..|..|...|.|   :.|..|.|.|:...|:
  Fly   203 LDKSASERNSKKRKGPPKVYKCNEEACNQTFRTERDLRGHRWKHTG---IFCDICGKPFTQSGNM 264

  Fly   245 LRHMEVHWDKKKYQCDKCGERF----SLS------------------------WLMYNHLMRHDA 281
            :||.:.|...|.::|.:|...|    .||                        .::..|:.||..
  Fly   265 MRHRQRHSGIKPHKCPECDATFYTQKELSSHSICHTGRMPCICEVCGRPCRDRGVLTAHMRRHTG 329

  Fly   282 EENA---------------------------LICEVCHQQFKTKRTYKHHLRTHQTDRPRYPCPD 319
            |..|                           .:|:||...|:.|:..:.|...|...| :|.|..
  Fly   330 ERPAKCEVCGKAFYSFHDLNVHAVSHTNLRPFVCDVCGSTFQRKKALRVHKLLHSEQR-KYACKL 393

  Fly   320 CEKSFVDKYTLKVHKRVHQPVEKPESAEAKEATVT 354
            |.|:|.....|..|.|.|.|.....:.:....:||
  Fly   394 CGKTFAQSGGLNAHMRSHDPARVKGAVKPLPQSVT 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 5/21 (24%)
C2H2 Zn finger 231..251 CDD:275368 7/19 (37%)
C2H2 Zn finger 259..308 CDD:275368 16/103 (16%)
C2H2 Zn finger 288..303 CDD:275370 5/14 (36%)
zf-C2H2 315..337 CDD:278523 8/21 (38%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 5/21 (24%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
COG5048 <256..415 CDD:227381 35/159 (22%)
zf-H2C2_2 263..288 CDD:290200 8/24 (33%)
C2H2 Zn finger 279..327 CDD:275368 6/47 (13%)
zf-H2C2_2 320..342 CDD:290200 5/21 (24%)
C2H2 Zn finger 335..355 CDD:275368 0/19 (0%)
C2H2 Zn finger 363..383 CDD:275368 6/19 (32%)
zf-C2H2 389..411 CDD:278523 8/21 (38%)
C2H2 Zn finger 391..411 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449773
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.