DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and CG2120

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster


Alignment Length:259 Identity:61/259 - (23%)
Similarity:92/259 - (35%) Gaps:62/259 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 TALKEPERQP--------GEEDECEEFMKEEMLDEEFQFSEPDDSMPSSEEEF------FTETTE 170
            |.:.:|:|.|        |::..|      ::.|..|            .|.:      .|.|.|
  Fly    78 TDMCKPKRTPTTKRHRTTGKDHTC------DICDRRF------------SEAYNLRIHKMTHTDE 124

  Fly   171 IP--CHICGEMFSSQEVLERHIKADTCQKSEQATCNVCGLKVKDDEVLDLHMNLHEGKTELECRY 233
            .|  |..||:.|.....|..|....|.::..:  |::||...:....|.:|..||.|:....|..
  Fly   125 KPHVCVECGKGFRQLNKLRIHAVTHTAERPHK--CDICGKGFRYANYLTVHRRLHTGEKPYPCLA 187

  Fly   234 CDKKFS----HKRNV---LRH-MEVHWDKK--------------KYQCDKCGERFSLSWLMYNHL 276
            .|...|    |.|.:   ||| .:...|.:              .:.|..|....:....:..||
  Fly   188 TDCHLSFHSIHARRIHTKLRHAAQTDPDPEHPLAEQEQRDTSALSFTCPVCSRVLTDQCYLSIHL 252

  Fly   277 MRHDAEENALIC--EVCHQQFKTKRTYKHHLRTHQTDRPRYPCPDCEKSFVDKYTLKVHKRVHQ 338
            .|| ..:....|  ..|.::|.:....|||...|...|| :.||.|...|:.|...|.|.:||:
  Fly   253 KRH-YNQRDFPCPQPECGKRFFSASELKHHQIAHTQQRP-FACPLCPARFLRKSNHKQHLKVHE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 5/19 (26%)
C2H2 Zn finger 231..251 CDD:275368 8/27 (30%)
C2H2 Zn finger 259..308 CDD:275368 12/50 (24%)
C2H2 Zn finger 288..303 CDD:275370 3/16 (19%)
zf-C2H2 315..337 CDD:278523 7/21 (33%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 4/37 (11%)
zf-H2C2_2 113..138 CDD:290200 8/24 (33%)
C2H2 Zn finger 129..149 CDD:275368 6/19 (32%)
zf-H2C2_2 142..166 CDD:290200 6/25 (24%)
COG5048 151..>264 CDD:227381 23/115 (20%)
C2H2 Zn finger 157..177 CDD:275368 5/19 (26%)
C2H2 Zn finger 185..206 CDD:275368 5/20 (25%)
C2H2 Zn finger 235..255 CDD:275368 4/19 (21%)
C2H2 Zn finger 263..285 CDD:275368 6/21 (29%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446556
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.